Citrus Sinensis ID: 021419

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--

MPGKRHVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQTKFNLQREKSEGYAKLGIPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDFAAVITGEERPTIIL

ccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHcccccEEEcccEEEEHHcccccHHHHccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccc

ccHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHHHcccccHHHHHcccEEEEccHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHcHccccccEEEc

MPGKRHVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAqdlkgkevkvNTSLLYQQTKFNlqreksegyaklgipmsSVEVLEINSKITAACksedqtggRDLVAKIKKWIKESernkrcivdyGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKsgdlsrrrnTVLVLREVISSDHRRVNMFLEIEGAIESLYTLikepicptateaSFVVVYHMItsasaadkpiQKFVDMGLVSLLLETLVDAQRSlcekpwvfstDFAAvitgeerptiil

MPGKRHVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKaqdlkgkevKVNTSLLyqqtkfnlqreksegyaKLGIPMSSVEVLEINSKITaacksedqtggrdLVAKIKKwikesernkrcivDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKsgdlsrrrnTVLVLrevissdhrrvnMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSasaadkpiQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDfaavitgeerptiil

*****HVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQTKFNLQREKSEGYAKLGIPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDFAAVITG********

*****HV*LINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQTKFN****************SSVEVLEINSKITAACK*******RDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEAL**LGSASSMHCMVWFLKSGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDFAAVITGEERPTII*

*PGKRHVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQTKFNLQREKSEGYAKLGIPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDFAAVITGEERPTIIL

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		312	2.2.26 [Sep-21-2011]
Q5PNY6		435	U-box domain-containing p	no	no	0.644	0.462	0.358	2e-27
Q9C8D1		431	U-box domain-containing p	no	no	0.625	0.452	0.293	2e-20
C1FXW9		1613	THO complex subunit 2 OS=	N/A	no	0.185	0.035	0.457	2e-05
B2KI97		1576	THO complex subunit 2 OS=	N/A	no	0.185	0.036	0.457	2e-05
Q8NI27		1593	THO complex subunit 2 OS=	yes	no	0.185	0.036	0.457	2e-05
B1AZI6		1594	THO complex subunit 2 OS=	no	no	0.185	0.036	0.457	2e-05
B1MTK1		1600	THO complex subunit 2 OS=	N/A	no	0.185	0.036	0.457	2e-05
B0KWH8		1600	THO complex subunit 2 OS=	yes	no	0.185	0.036	0.457	2e-05

>sp\|Q5PNY6\|PUB21_ARATH U-box domain-containing protein 21 OS=Arabidopsis thaliana GN=PUB21 PE=2 SV=1	Back alignment and function desciption

 Score =  123 bits (309), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 127/212 (59%), Gaps = 11/212 (5%)

Query: 82  IPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAA 141
           +P+   EV EI+ K+++A +  D      ++ KIKK   ESE+N++C+ +     VL   
Sbjct: 114 VPLMPCEVYEISRKLSSATRRGDYEKCGVIIEKIKKLGDESEKNRKCVNENSVGWVLCDC 173

Query: 142 FESFSKTCLDEHVS-VLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRR 200
           F+ FS    DE ++ +L EILS LT +FP+  E ++ L SA+S  C+   LKS D S R+
Sbjct: 174 FDKFSG---DEKLTFMLNEILSLLTWMFPIGLEGISKLASATSFRCVAGLLKSTDDSVRQ 230

Query: 201 NTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAA 260
           N   +++E++S D  RV+ F    G  E+L  LI++ +  ++T++S + +Y M+      
Sbjct: 231 NAAFIMKEILSLDETRVHSFAVENGVAEALVKLIRDSVSSSSTKSSLIAIYQMVLQ---- 286

Query: 261 DKP--IQKFVDMGLVSLLLETLVDAQRSLCEK 290
            KP    +F+++GLVS+ +E +VDA+ S+CEK
Sbjct: 287 -KPEIASEFLEIGLVSITVEMIVDAENSVCEK 317

Functions as an E3 ubiquitin ligase.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|Q9C8D1\|PUB20_ARATH U-box domain-containing protein 20 OS=Arabidopsis thaliana GN=PUB20 PE=2 SV=1	Back alignment and function description

>sp\|C1FXW9\|THOC2_DASNO THO complex subunit 2 OS=Dasypus novemcinctus GN=THOC2 PE=3 SV=1	Back alignment and function description

>sp\|B2KI97\|THOC2_RHIFE THO complex subunit 2 OS=Rhinolophus ferrumequinum GN=THOC2 PE=3 SV=1	Back alignment and function description

>sp\|Q8NI27\|THOC2_HUMAN THO complex subunit 2 OS=Homo sapiens GN=THOC2 PE=1 SV=2	Back alignment and function description

>sp\|B1AZI6\|THOC2_MOUSE THO complex subunit 2 OS=Mus musculus GN=Thoc2 PE=3 SV=1	Back alignment and function description

>sp\|B1MTK1\|THOC2_CALMO THO complex subunit 2 OS=Callicebus moloch GN=THOC2 PE=3 SV=1	Back alignment and function description

>sp\|B0KWH8\|THOC2_CALJA THO complex subunit 2 OS=Callithrix jacchus GN=THOC2 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		312
14582200		442	immediate-early fungal elicitor protein	0.669	0.472	0.542	3e-60
118487984		441	unknown [Populus trichocarpa]	0.666	0.471	0.614	6e-60
255573216		426	Spotted leaf protein, putative [Ricinus	0.625	0.457	0.569	2e-57
359473099		442	PREDICTED: U-box domain-containing prote	0.669	0.472	0.569	2e-55
224077352		448	predicted protein [Populus trichocarpa]	0.698	0.486	0.475	3e-52
224069206		446	predicted protein [Populus trichocarpa]	0.669	0.468	0.473	2e-49
449456206		442	PREDICTED: U-box domain-containing prote	0.669	0.472	0.473	4e-49
449530496		442	PREDICTED: LOW QUALITY PROTEIN: U-box do	0.669	0.472	0.468	1e-48
30013683		445	Avr9/Cf-9 rapidly elicited protein 74 [N	0.717	0.503	0.469	3e-48
449449104		444	PREDICTED: U-box domain-containing prote	0.669	0.470	0.474	1e-47

>gi\|14582200\|gb\|AAK69401.1\|AF274564_1 immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] gi\|14582202\|gb\|AAK69402.1\|AF274565_1 immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum]	Back alignment and taxonomy information

 Score =  238 bits (607), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 164/212 (77%), Gaps = 3/212 (1%)

Query: 82  IPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAA 141
           IP+SS +V E+ SK+ AAC+ E+ +  ++LV KIK+ +KE+ERNKRC V  G V VLA+ 
Sbjct: 113 IPVSSHQVTEMLSKVVAACRREEASACQELVGKIKRLVKENERNKRCFVANGTVGVLAST 172

Query: 142 FESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRRN 201
           FE+FSK   D++V+VLEEILS L+L+ PL GEA  +LGS SS++CMVWFLKSGDLS R N
Sbjct: 173 FEAFSKLSFDKNVAVLEEILSCLSLMTPLDGEAKAFLGSNSSLNCMVWFLKSGDLSARAN 232

Query: 202 TVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAA- 260
           +VLVL+ V+S+D +++  F  IEG++E+L  +IKEP+ PT T+AS ++VY+M++++S++ 
Sbjct: 233 SVLVLKHVLSTDQKKMEEFSMIEGSLEALVKVIKEPVSPTTTKASLLIVYYMVSTSSSSR 292

Query: 261 --DKPIQKFVDMGLVSLLLETLVDAQRSLCEK 290
             DK I +F+DMGL+  LLE LVD  +S+CEK
Sbjct: 293 VDDKIIARFIDMGLIERLLEMLVDCDKSICEK 324

Source: Petroselinum crispum

Species: Petroselinum crispum

Genus: Petroselinum

Family: Apiaceae

Order: Apiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|118487984\|gb\|ABK95813.1\| unknown [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255573216\|ref\|XP_002527537.1\| Spotted leaf protein, putative [Ricinus communis] gi\|223533087\|gb\|EEF34846.1\| Spotted leaf protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359473099\|ref\|XP_003631249.1\| PREDICTED: U-box domain-containing protein 21-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224077352\|ref\|XP_002305224.1\| predicted protein [Populus trichocarpa] gi\|222848188\|gb\|EEE85735.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224069206\|ref\|XP_002302926.1\| predicted protein [Populus trichocarpa] gi\|222844652\|gb\|EEE82199.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449456206\|ref\|XP_004145841.1\| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449530496\|ref\|XP_004172231.1\| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 21-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|30013683\|gb\|AAP03884.1\| Avr9/Cf-9 rapidly elicited protein 74 [Nicotiana tabacum]	Back alignment and taxonomy information

>gi\|449449104\|ref\|XP_004142305.1\| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus] gi\|449523075\|ref\|XP_004168550.1\| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		312
TAIR\|locus:2169861		435	AT5G37490 [Arabidopsis thalian	0.644	0.462	0.358	1.4e-30
TAIR\|locus:2075457		379	AT3G02840 [Arabidopsis thalian	0.724	0.596	0.336	1.4e-30
TAIR\|locus:2013850		431	CMPG1 ""CYS, MET, PRO, and GLY	0.628	0.454	0.295	1.8e-21
UNIPROTKB\|E1BSI5		1519	THOC2 "Uncharacterized protein	0.173	0.035	0.472	0.00052
RGD\|1561623		1570	Thoc2 "THO complex 2" [Rattus	0.173	0.034	0.472	0.00054
UNIPROTKB\|Q8NI27		1593	THOC2 "THO complex subunit 2"	0.173	0.033	0.472	0.00054
MGI\|MGI:2442413		1594	Thoc2 "THO complex 2" [Mus mus	0.173	0.033	0.472	0.00054
UNIPROTKB\|F1RU72		1601	THOC2 "Uncharacterized protein	0.173	0.033	0.472	0.00055

TAIR\|locus:2169861 AT5G37490 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
 Identities = 76/212 (35%), Positives = 127/212 (59%)

Query:    82 IPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAA 141
             +P+   EV EI+ K+++A +  D      ++ KIKK   ESE+N++C+ +     VL   
Sbjct:   114 VPLMPCEVYEISRKLSSATRRGDYEKCGVIIEKIKKLGDESEKNRKCVNENSVGWVLCDC 173

Query:   142 FESFSKTCLDEHVS-VLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRR 200
             F+ FS    DE ++ +L EILS LT +FP+  E ++ L SA+S  C+   LKS D S R+
Sbjct:   174 FDKFSG---DEKLTFMLNEILSLLTWMFPIGLEGISKLASATSFRCVAGLLKSTDDSVRQ 230

Query:   201 NTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAA 260
             N   +++E++S D  RV+ F    G  E+L  LI++ +  ++T++S + +Y M+      
Sbjct:   231 NAAFIMKEILSLDETRVHSFAVENGVAEALVKLIRDSVSSSSTKSSLIAIYQMVLQ---- 286

Query:   261 DKP--IQKFVDMGLVSLLLETLVDAQRSLCEK 290
              KP    +F+++GLVS+ +E +VDA+ S+CEK
Sbjct:   287 -KPEIASEFLEIGLVSITVEMIVDAENSVCEK 317

GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0016567 "protein ubiquitination" evidence=IEA

GO:0010200 "response to chitin" evidence=IEP;RCA

GO:0002679 "respiratory burst involved in defense response" evidence=RCA

GO:0009693 "ethylene biosynthetic process" evidence=RCA

GO:0035556 "intracellular signal transduction" evidence=RCA

TAIR\|locus:2075457 AT3G02840 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2013850 CMPG1 ""CYS, MET, PRO, and GLY protein 1"" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BSI5 THOC2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

RGD\|1561623 Thoc2 "THO complex 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8NI27 THOC2 "THO complex subunit 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:2442413 Thoc2 "THO complex 2" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RU72 THOC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00030628001	SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (442 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		312
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	99.88
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	99.83
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	99.6
KOG4224		550	consensus Armadillo repeat protein VAC8 required f	99.41
KOG4224		550	consensus Armadillo repeat protein VAC8 required f	99.38
PF05804		708	KAP: Kinesin-associated protein (KAP)	99.33
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	99.29
PF05804		708	KAP: Kinesin-associated protein (KAP)	99.18
PF04826		254	Arm_2: Armadillo-like; InterPro: IPR006911 This en	98.98
KOG0166		514	consensus Karyopherin (importin) alpha [Intracellu	98.97
cd00020		120	ARM Armadillo/beta-catenin-like repeats. An approx	98.92
KOG0166		514	consensus Karyopherin (importin) alpha [Intracellu	98.89
cd00020		120	ARM Armadillo/beta-catenin-like repeats. An approx	98.87
COG5064		526	SRP1 Karyopherin (importin) alpha [Intracellular t	98.54
PF10508		503	Proteasom_PSMB: Proteasome non-ATPase 26S subunit;	98.46
KOG4199		461	consensus Uncharacterized conserved protein [Funct	98.45
KOG1048		717	consensus Neural adherens junction protein Plakoph	98.38
PF04826		254	Arm_2: Armadillo-like; InterPro: IPR006911 This en	98.32
KOG2122		2195	consensus Beta-catenin-binding protein APC, contai	98.23
COG5064		526	SRP1 Karyopherin (importin) alpha [Intracellular t	98.15
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	98.11
KOG1222		791	consensus Kinesin associated protein KAP [Intracel	98.03
KOG1222		791	consensus Kinesin associated protein KAP [Intracel	97.98
PF10508		503	Proteasom_PSMB: Proteasome non-ATPase 26S subunit;	97.67
KOG2122		2195	consensus Beta-catenin-binding protein APC, contai	97.63
KOG4500		604	consensus Rho/Rac GTPase guanine nucleotide exchan	97.58
KOG4199		461	consensus Uncharacterized conserved protein [Funct	97.57
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	97.57
PF03224		312	V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004	97.48
KOG2160		342	consensus Armadillo/beta-catenin-like repeat-conta	97.4
KOG1048		717	consensus Neural adherens junction protein Plakoph	97.3
KOG4642		284	consensus Chaperone-dependent E3 ubiquitin protein	97.14
KOG4500		604	consensus Rho/Rac GTPase guanine nucleotide exchan	97.12
KOG0168		1051	consensus Putative ubiquitin fusion degradation pr	97.03
PF00514		41	Arm: Armadillo/beta-catenin-like repeat; InterPro:	96.95
PF03224		312	V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004	96.94
KOG2160		342	consensus Armadillo/beta-catenin-like repeat-conta	96.83
PF00514		41	Arm: Armadillo/beta-catenin-like repeat; InterPro:	96.79
PF14664		371	RICTOR_N: Rapamycin-insensitive companion of mTOR,	96.77
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	96.65
PF05536		543	Neurochondrin: Neurochondrin	96.53
PF13646		88	HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I	96.51
KOG0289		506	consensus mRNA splicing factor [General function p	96.18
KOG4646		173	consensus Uncharacterized conserved protein, conta	95.91
PF05536		543	Neurochondrin: Neurochondrin	95.88
COG5113		929	UFD2 Ubiquitin fusion degradation protein 2 [Postt	95.83
KOG4646		173	consensus Uncharacterized conserved protein, conta	95.59
smart00185		41	ARM Armadillo/beta-catenin-like repeats. Approx. 4	95.45
smart00185		41	ARM Armadillo/beta-catenin-like repeats. Approx. 4	95.4
KOG3036		293	consensus Protein involved in cell differentiation	95.32
cd00256		429	VATPase_H VATPase_H, regulatory vacuolar ATP synth	95.14
PRK09687		280	putative lyase; Provisional	94.97
PF12348		228	CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi	94.85
KOG2042		943	consensus Ubiquitin fusion degradation protein-2 [	94.73
KOG0168		1051	consensus Putative ubiquitin fusion degradation pr	94.45
PF10165		446	Ric8: Guanine nucleotide exchange factor synembryn	94.41
PRK09687		280	putative lyase; Provisional	94.39
cd00256		429	VATPase_H VATPase_H, regulatory vacuolar ATP synth	94.11
PF13646		88	HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I	94.09
KOG3678		832	consensus SARM protein (with sterile alpha and arm	93.4
PF04078		262	Rcd1: Cell differentiation family, Rcd1-like ; Int	93.08
KOG1293		678	consensus Proteins containing armadillo/beta-caten	93.03
KOG1789		2235	consensus Endocytosis protein RME-8, contains DnaJ	92.78
KOG1789		2235	consensus Endocytosis protein RME-8, contains DnaJ	92.58
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	92.32
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	91.94
KOG2171		1075	consensus Karyopherin (importin) beta 3 [Nuclear s	91.85
PTZ00429		746	beta-adaptin; Provisional	91.42
PF01602		526	Adaptin_N: Adaptin N terminal region; InterPro: IP	91.25
PF13513		55	HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O	90.64
COG5096		757	Vesicle coat complex, various subunits [Intracellu	90.3
PF14664		371	RICTOR_N: Rapamycin-insensitive companion of mTOR,	90.03
KOG1293		678	consensus Proteins containing armadillo/beta-caten	89.92
PF09759		102	Atx10homo_assoc: Spinocerebellar ataxia type 10 pr	89.78
PF01602		526	Adaptin_N: Adaptin N terminal region; InterPro: IP	88.93
PF12031		257	DUF3518: Domain of unknown function (DUF3518); Int	88.7
PF12348		228	CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi	88.14
KOG1242		569	consensus Protein containing adaptin N-terminal re	88.0
PF11841		160	DUF3361: Domain of unknown function (DUF3361)	87.29
PTZ00429		746	beta-adaptin; Provisional	87.04
PF12755		97	Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region	86.6
PF09759		102	Atx10homo_assoc: Spinocerebellar ataxia type 10 pr	86.54
KOG2973		353	consensus Uncharacterized conserved protein [Funct	86.34
PF08045		257	CDC14: Cell division control protein 14, SIN compo	86.01
PF11841		160	DUF3361: Domain of unknown function (DUF3361)	84.99
PF11701		157	UNC45-central: Myosin-binding striated muscle asse	84.85
PF08045		257	CDC14: Cell division control protein 14, SIN compo	84.82
KOG2734		536	consensus Uncharacterized conserved protein [Funct	83.99
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	83.7
PF06371		187	Drf_GBD: Diaphanous GTPase-binding Domain; InterPr	83.3
PF02985		31	HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re	82.77
PF10165		446	Ric8: Guanine nucleotide exchange factor synembryn	82.19
PF13513		55	HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O	80.86
COG5096		757	Vesicle coat complex, various subunits [Intracellu	80.74
PF12717		178	Cnd1: non-SMC mitotic condensation complex subunit	80.38
KOG2611		698	consensus Neurochondrin/leucine-rich protein (Neur	80.16

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

Probab=99.88  E-value=1.5e-21  Score=215.00  Aligned_cols=194  Identities=15%  Similarity=0.109  Sum_probs=163.0

Q ss_pred             hhHHHHHHHHHHHhchhhhHHHHhcCCHHHHHHHhhcccccccchhHHHHHHHHHHHHhcCCCChhHHHhccCCCCHHHH
Q 021419          108 GRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCM  187 (312)
Q Consensus       108 ~~~al~~l~~lak~s~~nR~~l~~aG~v~~Lv~lL~s~~~~~~~~~~~v~e~Al~iL~~L~~~~~e~k~~l~~~~~l~~l  187 (312)
                      +..|+++|+.+++++++||+||+++|++++|+.+|+.....   ......++++++|.    .+++.+..+..+++++++
T Consensus      1165 ~~~AL~kLr~LA~EserNR~~maeaGAle~L~kvLSl~~s~---s~e~a~~ElL~IL~----~~~e~~~~l~a~~~v~~L 1237 (2102)
T PLN03200       1165 PPLALGLLTQLAEGSDVNKLAMAEAGALDALTKYLSLGPQD---STEEAASELLRILF----SSPELRRHESAFGAVNQL 1237 (2102)
T ss_pred             hHHHHHHHHHHHhcCHHHHHHHHHcCCHHHHHHHHHhcCcc---chhHHHHHHHHHHh----CCHHHHHHhhhhhHHHHH
Confidence            56799999999999999999999999999999999765321   12455677777755    366777888888899999


Q ss_pred             HHHHhcCCHHHHHHHHHHHHHHhccchHH-------------HH-----HhhhhhchHHHHHHhhcCCCChHHHH-----
Q 021419          188 VWFLKSGDLSRRRNTVLVLREVISSDHRR-------------VN-----MFLEIEGAIESLYTLIKEPICPTATE-----  244 (312)
Q Consensus       188 v~~L~~gs~~~r~~Aa~lL~~Ls~~~~~~-------------~~-----~Ig~~~g~i~~LV~ll~~~~~~~a~~-----  244 (312)
                      +++|++|+.++|.+|+.+|++|... +++             ..     ..+..++++.+|++++++..++++.+     
T Consensus      1238 v~vL~~Gs~~aR~~Aa~aL~~L~~~-~~~~~~~~a~~ai~pLv~ll~~~~~~~~~~a~~ALvkL~kd~is~~a~~~~~~~ 1316 (2102)
T PLN03200       1238 VAVLRLGSRSARYSAARALQELFSA-EHIRDSELARQAVQPLVEMLNTGSESEQHAAIGALIKLSSGNPSKALAIADVEG 1316 (2102)
T ss_pred             HHHHhcCCHHHHHHHHHHHHHHHhh-hhhhhhhhhhccchHHHHHhcccchhhhHHHHHHHHHHHcCCCChHhHhhcccc
Confidence            9999999999999999999999766 442             22     33455688999999999988999999     


Q ss_pred             HHHHH----------------HHHhhcCCCCCcchHHHHHHcCcHHHHHHHhhhcccch-hhhhh-----ccCCHHHHHH
Q 021419          245 ASFVV----------------VYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSL-CEKPW-----VFSTDFAAVI  302 (312)
Q Consensus       245 ~Al~a----------------L~~L~~~~~~~~~Nr~~~V~~G~V~~LvelL~~~~~~~-~e~aL-----L~~~~eGR~a  302 (312)
                      .++.+                +++||.+--++++||.++|++|+|++||++|.+ +++. +|+++     ||.|+|||++
T Consensus      1317 a~L~~l~~iL~~~~~~~l~~~l~~Lc~~l~~~~~~R~~~v~agaV~~LIeLL~d-e~~~~~E~Al~vLd~Lc~~eegre~ 1395 (2102)
T PLN03200       1317 NALENLCKILSSDSSLELKEDAAELCRVLFTNTRIRSTPAAARCIEPLISLLVS-ESSTAQEAGVCALDRLLDDEQLAEL 1395 (2102)
T ss_pred             hhHHHHHHhcccccchhHHHHHHHHhHHhcCChHHHhhHHHhCCHHHHHHHHhc-cCchHHHHHHHHHHHHhcCHhhHHH
Confidence            99999                888887422236899999999999999999998 6665 99999     9999999999


Q ss_pred             HhhcCCcc
Q 021419          303 TGEERPTI  310 (312)
Q Consensus       303 i~~~~~~~  310 (312)
                      +..|+.+|
T Consensus      1396 ~~~h~a~v 1403 (2102)
T PLN03200       1396 VAAHGAVV 1403 (2102)
T ss_pred             HHHcCChh
Confidence            99999987

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF05804 KAP: Kinesin-associated protein (KAP)	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>PF05804 KAP: Kinesin-associated protein (KAP)	Back alignment and domain information

>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function	Back alignment and domain information

>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd00020 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd00020 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion]	Back alignment and domain information

>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells	Back alignment and domain information

>KOG4199 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function	Back alignment and domain information

>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells	Back alignment and domain information

>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms]	Back alignment and domain information

>KOG4199 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms]	Back alignment and domain information

>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless	Back alignment and domain information

>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless	Back alignment and domain information

>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF05536 Neurochondrin: Neurochondrin	Back alignment and domain information

>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown]	Back alignment and domain information

>PF05536 Neurochondrin: Neurochondrin	Back alignment and domain information

>COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown]	Back alignment and domain information

>smart00185 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>smart00185 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only]	Back alignment and domain information

>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments	Back alignment and domain information

>PRK09687 putative lyase; Provisional	Back alignment and domain information

>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ]	Back alignment and domain information

>KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway []	Back alignment and domain information

>PRK09687 putative lyase; Provisional	Back alignment and domain information

>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments	Back alignment and domain information

>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A	Back alignment and domain information

>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures]	Back alignment and domain information

>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms []	Back alignment and domain information

>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only]	Back alignment and domain information

>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PTZ00429 beta-adaptin; Provisional	Back alignment and domain information

>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B	Back alignment and domain information

>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion]	Back alignment and domain information

>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term	Back alignment and domain information

>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only]	Back alignment and domain information

>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10	Back alignment and domain information

>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised	Back alignment and domain information

>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ]	Back alignment and domain information

>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF11841 DUF3361: Domain of unknown function (DUF3361)	Back alignment and domain information

>PTZ00429 beta-adaptin; Provisional	Back alignment and domain information

>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region	Back alignment and domain information

>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10	Back alignment and domain information

>KOG2973 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1	Back alignment and domain information

>PF11841 DUF3361: Domain of unknown function (DUF3361)	Back alignment and domain information

>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle	Back alignment and domain information

>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1	Back alignment and domain information

>KOG2734 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division []	Back alignment and domain information

>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 []	Back alignment and domain information

>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway []	Back alignment and domain information

>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B	Back alignment and domain information

>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion]	Back alignment and domain information

>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1	Back alignment and domain information

>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		312
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-05
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	1e-04
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	6e-04
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	2e-04
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	2e-04
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	7e-04
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	2e-04
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	7e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 44.8 bits (105), Expect = 3e-05
 Identities = 33/237 (13%), Positives = 71/237 (29%), Gaps = 64/237 (27%)

Query: 8   RLINLAKWLVES--AWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQT 65
           RL     W + S    +  +  +E       +    IK + +             +Y + 
Sbjct: 66  RLF----WTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTR------MYIEQ 115

Query: 66  KFNLQREKSEGYAKLGIPMSSVEVLEINSKITAACKSEDQTGGR-DLVAKIKKWIKESER 124
           +  L  + ++ +AK  +                          R     K+++ + E   
Sbjct: 116 RDRLYND-NQVFAKYNVS-------------------------RLQPYLKLRQALLELRP 149

Query: 125 NKRCIVDYGAV----SVLAAA------------FESF--SKTCLDEHVSVLEEILSTLTL 166
            K  ++  G +    + +A              F+ F  +    +   +VLE +L  L  
Sbjct: 150 AKNVLI-DGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLE-MLQKLLY 207

Query: 167 LFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRR---NTVLVLREVISSDHRRVNMF 220
                  + +   S   +       +   L + +   N +LVL  V   + +  N F
Sbjct: 208 QIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNV--QNAKAWNAF 262

PyMOL of 1vt4

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		312
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	99.8
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	99.79
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	99.76
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	99.75
4hxt_A		252	De novo protein OR329; structural genomics, PSI-bi	99.75
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	99.75
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	99.73
3nmz_A		458	APC variant protein; protein-protein complex, arma	99.71
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	99.7
3nmz_A		458	APC variant protein; protein-protein complex, arma	99.69
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	99.68
4hxt_A		252	De novo protein OR329; structural genomics, PSI-bi	99.68
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	99.65
1xqr_A		296	HSPBP1 protein; armadillo repeat, superhelical twi	99.63
3ul1_B		510	Importin subunit alpha-2; arm repeat, armadillo re	99.62
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	99.58
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	99.56
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	99.56
4b8j_A		528	Importin subunit alpha-1A; transport protein, nucl	99.56
3tpo_A		529	Importin subunit alpha-2; nuclear import, protein	99.54
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	99.53
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	99.53
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	99.51
3tpo_A		529	Importin subunit alpha-2; nuclear import, protein	99.51
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	99.5
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	99.5
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	99.49
3ul1_B		510	Importin subunit alpha-2; arm repeat, armadillo re	99.49
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	99.47
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	99.47
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	99.47
4b8j_A		528	Importin subunit alpha-1A; transport protein, nucl	99.45
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	99.44
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	99.43
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	99.42
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	99.4
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	99.4
3m62_A		968	Ubiquitin conjugation factor E4; armadillo-like re	99.39
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	99.38
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	99.38
1xqr_A		296	HSPBP1 protein; armadillo repeat, superhelical twi	99.35
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	99.33
3opb_A		778	SWI5-dependent HO expression protein 4; heat and a	99.33
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	99.18
3grl_A		651	General vesicular transport factor P115; vesicle t	99.03
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	99.01
3opb_A		778	SWI5-dependent HO expression protein 4; heat and a	98.91
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	98.76
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	98.43
3grl_A		651	General vesicular transport factor P115; vesicle t	98.32
4gmo_A		684	Putative uncharacterized protein; ARM, heat, solen	97.86
3ltj_A		201	Alpharep-4; protein engineering, heat-like repeat,	97.78
3ltm_A		211	Alpha-REP4; protein engineering, heat-like repeat,	97.67
3ltj_A		201	Alpharep-4; protein engineering, heat-like repeat,	97.36
3ltm_A		211	Alpha-REP4; protein engineering, heat-like repeat,	97.34
4gmo_A		684	Putative uncharacterized protein; ARM, heat, solen	97.08
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	97.01
1oyz_A		280	Hypothetical protein YIBA; structural genomics, PS	96.63
1oyz_A		280	Hypothetical protein YIBA; structural genomics, PS	96.57
3dad_A		339	FH1/FH2 domain-containing protein 1; formin, FHOD1	96.16
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	96.03
1te4_A		131	Conserved protein MTH187; methanobacterium thermoa	95.81
1z6u_A		150	NP95-like ring finger protein isoform B; structura	95.72
2qk2_A		242	LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2	95.6
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	95.54
4fdd_A		852	Transportin-1; heat repeats, karyopherin, nuclear	95.5
2qk2_A		242	LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2	95.24
1b3u_A		588	Protein (protein phosphatase PP2A); scaffold prote	94.95
3b2a_A		265	TON_1937, putative uncharacterized protein; heat-r	94.59
4fdd_A		852	Transportin-1; heat repeats, karyopherin, nuclear	94.48
1b3u_A		588	Protein (protein phosphatase PP2A); scaffold prote	94.46
3dad_A		339	FH1/FH2 domain-containing protein 1; formin, FHOD1	94.3
2vgl_B		591	AP-2 complex subunit beta-1; cytoplasmic vesicle,	93.95
1te4_A		131	Conserved protein MTH187; methanobacterium thermoa	93.82
2vgl_B		591	AP-2 complex subunit beta-1; cytoplasmic vesicle,	93.76
1w63_A		618	Adapter-related protein complex 1 gamma 1 subunit;	93.76
2qk1_A		249	Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h	93.72
2qk1_A		249	Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h	93.56
2fv2_A		268	RCD1 required for cell differentiation1 homolog; a	93.24
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	93.08
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	93.06
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	91.94
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	91.91
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	91.78
3b2a_A		265	TON_1937, putative uncharacterized protein; heat-r	91.7
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	91.57
1w63_A		618	Adapter-related protein complex 1 gamma 1 subunit;	91.52
1ibr_B		462	P95, importin beta-1 subunit, nuclear factor; smal	91.24
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	90.29
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	90.16
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	90.09
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	89.2
2bpt_A		861	Importin beta-1 subunit; nuclear transport, nucleo	88.57
1ibr_B		462	P95, importin beta-1 subunit, nuclear factor; smal	88.5
1u6g_C		1230	TIP120 protein, CAND1; cullin repeat, heat repeat,	88.46
1qgr_A		876	Protein (importin beta subunit); transport recepto	87.48
1qgr_A		876	Protein (importin beta subunit); transport recepto	87.0
2vgl_A		621	Adaptor protein complex AP-2, alpha 2 subunit; cyt	86.86
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	86.37
2bpt_A		861	Importin beta-1 subunit; nuclear transport, nucleo	85.17
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	85.1
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	83.29
3eg5_B		383	Protein diaphanous homolog 1; protein-protein comp	82.98
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	82.48
1u6g_C		1230	TIP120 protein, CAND1; cullin repeat, heat repeat,	82.14
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	81.21

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	Back alignment and structure

Probab=99.80  E-value=1.2e-18  Score=156.97  Aligned_cols=178  Identities=12%  Similarity=0.083  Sum_probs=150.9

Q ss_pred             HHHHHHHHHHhcccCCCc--hhhhHHHHHHHHHHHhchhhhHHHHhcCCHHHHHHHhhcccccccchhHHHHHHHHHHHH
Q 021419           88 EVLEINSKITAACKSEDQ--TGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLT  165 (312)
Q Consensus        88 ~v~~ll~~l~~~~~~~d~--~~~~~al~~l~~lak~s~~nR~~l~~aG~v~~Lv~lL~s~~~~~~~~~~~v~e~Al~iL~  165 (312)
                      .+..+++.|.+    +|+  +.+..|+..|+.++.+++.||..+.++|++|.|+.+|.+.       +.+++++|..+|.
T Consensus         9 ~i~~lV~lL~s----~~~~~~~q~~Aa~~l~~L~~~~~~~r~~I~~~G~Ip~LV~lL~s~-------~~~vq~~Aa~aL~   77 (233)
T 3tt9_A            9 TLERAVSMLEA----DHMLPSRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLLKVQ-------NEDVQRAVCGALR   77 (233)
T ss_dssp             CHHHHHHTCCS----SCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHTTHHHHHHHGGGCC-------CHHHHHHHHHHHH
T ss_pred             cHHHHHHHhCC----CCchHHHHHHHHHHHHHHHcCCcHHHHHHHHcCCHHHHHHHHcCC-------CHHHHHHHHHHHH
Confidence            45667777754    455  5567799999999999999999999999999999999765       3579999999999


Q ss_pred             hcCCCChhHHHhccCCCCHHHHHHHHh-cCCHHHHHHHHHHHHHHhccchHHHHHhhhhhchHHHHHHhhc---CC----
Q 021419          166 LLFPLAGEALTYLGSASSMHCMVWFLK-SGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIK---EP----  237 (312)
Q Consensus       166 ~L~~~~~e~k~~l~~~~~l~~lv~~L~-~gs~~~r~~Aa~lL~~Ls~~~~~~~~~Ig~~~g~i~~LV~ll~---~~----  237 (312)
                      +|+..++++|..|.+.|+|+.++++|+ +++.+.+++|+.+|.+||.. +.++..|.+  ++++.|++++.   .|    
T Consensus        78 nLa~~~~~nk~~I~~~GaI~~Lv~lL~~~~~~~~~e~a~~aL~nLS~~-~~~k~~i~~--~~i~~Lv~ll~~p~sG~~~~  154 (233)
T 3tt9_A           78 NLVFEDNDNKLEVAELNGVPRLLQVLKQTRDLETKKQITGLLWNLSSN-DKLKNLMIT--EALLTLTENIIIPFSGWPEG  154 (233)
T ss_dssp             HHHTTCHHHHHHHHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHHTS-GGGHHHHHH--HHHHHHCCCCCHHHHCCCGG
T ss_pred             HHHhCCHHHHHHHHHcCCHHHHHHHHccCCCHHHHHHHHHHHHHHHcC-hhhHHHHHh--ccHHHHHHHHhccccCCccc
Confidence            997767899999999999999999998 57999999999999999865 667888855  57999998763   11    


Q ss_pred             --------CChHHHHHHHHHHHHhhcCCCCCcchHHHHHHc-CcHHHHHHHhhh
Q 021419          238 --------ICPTATEASFVVVYHMITSASAADKPIQKFVDM-GLVSLLLETLVD  282 (312)
Q Consensus       238 --------~~~~a~~~Al~aL~~L~~~~~~~~~Nr~~~V~~-G~V~~LvelL~~  282 (312)
                              .++.....|.-+|.||++..   +++|..|.+. |.|+.|+.+|..
T Consensus       155 ~~~~~~~~~~~~v~~na~~~L~nLss~~---~~~R~~~r~~~Gli~~Lv~~l~~  205 (233)
T 3tt9_A          155 DYPKANGLLDFDIFYNVTGCLRNMSSAG---ADGRKAMRRCDGLIDSLVHYVRG  205 (233)
T ss_dssp             GCCCCCTTCCHHHHHHHHHHHHHHTTSC---HHHHHHHHTSTTHHHHHHHHHHH
T ss_pred             ccccccccchHHHHHHHHHHHHHHhcCC---HHHHHHHHHCCCcHHHHHHHHHh
Confidence                    25688999999999998864   4799999986 799999999975

PyMOL of 3tt9

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct}	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A	Back alignment and structure

>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene}	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens}	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens}	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct}	Back alignment and structure

>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene}	Back alignment and structure

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	Back alignment and structure

>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A*	Back alignment and structure

>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ...	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster}	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A	Back alignment and structure

>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A	Back alignment and structure

>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens}	Back alignment and structure

>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A	Back alignment and structure

>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ...	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens}	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A	Back alignment and structure

>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio}	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster}	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio}	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A	Back alignment and structure

>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A	Back alignment and structure

>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A*	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A	Back alignment and structure

>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A	Back alignment and structure

>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic}	Back alignment and structure

>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic}	Back alignment and structure

>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic}	Back alignment and structure

>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic}	Back alignment and structure

>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16	Back alignment and structure

>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16	Back alignment and structure

>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster}	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B*	Back alignment and structure

>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster}	Back alignment and structure

>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A	Back alignment and structure

>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus}	Back alignment and structure

>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B*	Back alignment and structure

>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A	Back alignment and structure

>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens}	Back alignment and structure

>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B	Back alignment and structure

>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16	Back alignment and structure

>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B	Back alignment and structure

>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1	Back alignment and structure

>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus}	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1	Back alignment and structure

>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A	Back alignment and structure

>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A	Back alignment and structure

>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A	Back alignment and structure

>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A	Back alignment and structure

>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A	Back alignment and structure

>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B*	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		312
d1xqra1		264	Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi	99.6
d1jdha_		529	beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	99.5
d1jdha_		529	beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	99.49
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	99.48
d1q1sc_		434	Importin alpha {Mouse (Mus musculus) [TaxId: 10090	99.34
d1q1sc_		434	Importin alpha {Mouse (Mus musculus) [TaxId: 10090	99.33
d1xm9a1		457	Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	99.32
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	99.31
d1xqra1		264	Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi	99.31
d1xm9a1		457	Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	99.29
d1wa5b_		503	Karyopherin alpha {Baker's yeast (Saccharomyces ce	99.28
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	99.2
d1wa5b_		503	Karyopherin alpha {Baker's yeast (Saccharomyces ce	99.17
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	98.49
d1te4a_		111	MTH187 {Archaeon Methanobacterium thermoautotrophi	96.41
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	96.26
d1te4a_		111	MTH187 {Archaeon Methanobacterium thermoautotrophi	95.03
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	94.59
d1b3ua_		588	Constant regulatory domain of protein phosphatase	93.88
d2vglb_		579	Adaptin beta subunit N-terminal fragment {Human (H	93.41
d1oyza_		276	Hypothetical protein YibA {Escherichia coli [TaxId	93.25
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	93.18
d2vglb_		579	Adaptin beta subunit N-terminal fragment {Human (H	92.09
d1b3ua_		588	Constant regulatory domain of protein phosphatase	90.52
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	90.38
d1oyza_		276	Hypothetical protein YibA {Escherichia coli [TaxId	90.13
d1ibrb_		458	Importin beta {Human (Homo sapiens) [TaxId: 9606]}	86.06
d2vgla_		584	Adaptin alpha C subunit N-terminal fragment {Mouse	83.14
d1u6gc_		1207	Cullin-associated NEDD8-dissociated protein 1 (Tip	82.26

>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HspBP1 domain
domain: Hsp70-binding protein 1 (HspBP1)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.60  E-value=1.7e-14  Score=128.23  Aligned_cols=190  Identities=9%  Similarity=0.096  Sum_probs=156.3

Q ss_pred             CchhhhHHHHHHHHHHHhchhhhHHHHhcCCHHHHHHH-hhcccccccchhHHHHHHHHHHHHhcCCCChhHHHhccCCC
Q 021419          104 DQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAA-FESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSAS  182 (312)
Q Consensus       104 d~~~~~~al~~l~~lak~s~~nR~~l~~aG~v~~Lv~l-L~s~~~~~~~~~~~v~e~Al~iL~~L~~~~~e~k~~l~~~~  182 (312)
                      |.+.+..|+..|..++.. ..|++.++..|.++.|+.. +.+.       +.+++..|+.+|..++..++..+..+.+.+
T Consensus        30 ~~~~~~~Al~~L~~L~~~-~d~a~~l~~~gg~~~ll~~ll~s~-------~~~vr~~A~~~L~~l~~~~~~~~~~~~~~~  101 (264)
T d1xqra1          30 DQQEREGALELLADLCEN-MDNAADFCQLSGMHLLVGRYLEAG-------AAGLRWRAAQLIGTCSQNVAAIQEQVLGLG  101 (264)
T ss_dssp             HHHHHHHHHHHHHHHHTS-HHHHHHHHHTTHHHHHHHTTTTCS-------SHHHHHHHHHHHHHHHTTCHHHHHHHHHTT
T ss_pred             CHHHHHHHHHHHHHHHcC-HHHHHHHHHcCCHHHHHHHHhCCC-------CHHHHHHHHHHHHHHHHHHHHHHHHHHHcC
Confidence            345567799999999964 4588889999999988875 5433       467999999999999776677788888889


Q ss_pred             CHHHHHHHHhcC-CHHHHHHHHHHHHHHhccchHHHHHhhhhhchHHHHHHhhcCCCChHHHHHHHHHHHHhhcCCCCCc
Q 021419          183 SMHCMVWFLKSG-DLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAAD  261 (312)
Q Consensus       183 ~l~~lv~~L~~g-s~~~r~~Aa~lL~~Ls~~~~~~~~~Ig~~~g~i~~LV~ll~~~~~~~a~~~Al~aL~~L~~~~~~~~  261 (312)
                      .++.++.+|.+. +.+.|..|+.+|..++...+.....+... |+++.|+++++++ ++.....|+.+|.+++...   +
T Consensus       102 ~i~~Lv~lL~~~~~~~v~~~a~~aL~~l~~~~~~~~~~~~~~-~gi~~L~~lL~~~-~~~~~~~a~~~L~~l~~~~---~  176 (264)
T d1xqra1         102 ALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRL-DGFSVLMRAMQQQ-VQKLKVKSAFLLQNLLVGH---P  176 (264)
T ss_dssp             HHHHHHHHHHHCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHT-THHHHHHHHHHSS-CHHHHHHHHHHHHHHHHHC---G
T ss_pred             chHHHHHHhhcCCCHHHHHHHHHHHHHHhccchhhHHHHHHh-hhhhHHHHHHhcC-chHHHHHHHHHHHHHHhcc---H
Confidence            999999999765 78899999999999987777777777565 9999999999987 8889999999999998654   4


Q ss_pred             chHHHHHHcCcHHHHHHHhhhcccchhhhhh-----cc-CCHHHHHHHhhc
Q 021419          262 KPIQKFVDMGLVSLLLETLVDAQRSLCEKPW-----VF-STDFAAVITGEE  306 (312)
Q Consensus       262 ~Nr~~~V~~G~V~~LvelL~~~~~~~~e~aL-----L~-~~~eGR~ai~~~  306 (312)
                      .++..+++.|+++.|+++|.+.+..+.+.++     |+ .+++++..+...
T Consensus       177 ~~~~~~~~~~~v~~L~~lL~~~~~~~~~~a~~aL~~L~~~~~~~~~~~~~~  227 (264)
T d1xqra1         177 EHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREP  227 (264)
T ss_dssp             GGHHHHHHTTHHHHHHHHHTSCCSTHHHHHHHHHHHHHTTCHHHHHHHHCG
T ss_pred             HHHHHHHHhhhHHHHHHHHcCCCHHHHHHHHHHHHHHHhcCHHHHHHHHHh
Confidence            7999999999999999999877777777777     43 366777666543

PyMOL of d1xqra1

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure