Citrus Sinensis ID: 021432

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MARRKLLLLLKPFDVYTVRQSNGISHITNPLILQHLENRCKVHKDAINFCQDILSKKPIEWEPVFRNNLSRPIRNVDLVVTVGGDGTLLQAGHLIDDSIPVLGVNSDPTRGEEVDMLSNEFDASRSKGYLCAATVNNFEQLLDNILEGKTVPSNLSRILIRVNSKSLPTFALNDILIAHPCPAMVSRFSFKIKSDGMPCSPLVNCRSSGLRVSTAAGSSAAMLSAGGFIMPILSHDLQYMVREPISPAAATSSLIHGLVKSDQSMEAMWFCKEGFVYIDGSHVFVSIQNGDVIEISSKAPALKVFLPPNLVY
cccEEEEEEEccccccccCCcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccCECccccccccccccccEEEEEccccHHHHHHHHccccccEEEECccccccccccccccccccccccCEEcccccccHHHHHHHHHccccccCEEEEEEEEEccCCcccccEEEEEECccccccEEEEEEEEccccccccccEEECccCEEEEccccHHHHHHcccccccccccccccEEEEECccccccccccEEEcccccEEEEEEEcccEEEEEEccccccEEcccccEEEEEEcccCEEEEccccccc
**RRKLLLLLKPFDVYTVRQSNGISHITNPLILQHLENRCKVHKDAINFCQDILSKKPIEWEPVFRNNLSRPIRNVDLVVTVGGDGTLLQAGHLIDDSIPVLGVNSDPTRGEEVDMLSNEFDASRSKGYLCAATVNNFEQLLDNILEGKTVPSNLSRILIRVNSKSLPTFALNDILIAHPCPAMVSRFSFKIKSDGMPCSPLVNCRSSGLRVSTAAGSSAAMLSAGGFIMPILSHDLQYMVREPISPAAATSSLIHGLVKSDQSMEAMWFCKEGFVYIDGSHVFVSIQNGDVIEISSKAPALKVFLPPNLV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARRKLLLLLKPFDVYTVRQSNGISHITNPLILQHLENRCKVHKDAINFCQDILSKKPIEWEPVFRNNLSRPIRNVDLVVTVGGDGTLLQAGHLIDDSIPVLGVNSDPTRGEEVDMLSNEFDASRSKGYLCAATVNNFEQLLDNILEGKTVPSNLSRILIRVNSKSLPTFALNDILIAHPCPAMVSRFSFKIKSDGMPCSPLVNCRSSGLRVSTAAGSSAAMLSAGGFIMPILSHDLQYMVREPISPAAATSSLIHGLVKSDQSMEAMWFCKEGFVYIDGSHVFVSIQNGDVIEISSKAPALKVFLPPNLVY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable NADH kinase Key source of the cellular reductant NADPH which is an important antioxidant factor.probableQ6EQG2
NADH kinase Phosphorylates specifically NADH. Can phosphorylate NAD with a 100-fold decrease in efficiency compared to NADH. Prefers ATP as nucleoside triphosphate substrate. Can also utilize UTP, GTP and CTP. Key source of the cellular reductant NADPH which is an important antioxidant factor.probableQ500Y9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.1.-Phosphotransferases with an alcohol group as acceptor.probable
2.7.1.86NADH kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U0T, chain A
Confidence level:very confident
Coverage over the Query: 11-47,76-107,126-312
View the alignment between query and template
View the model in PyMOL