Citrus Sinensis ID: 021444

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MDGLAKLKKYFHYFGYIPDLPSNFTDDFDDMLESAVKTYQKNFNLEPTGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALYGNNPNFNGSSVPTDQQRDTSGAHGAYFLGSCLGLSFFVVAAVLGL
cccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccEEccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEEcccccccEEEEccccccccccccccccccEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHcccc
ccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccEcccccHHHHHHHcccccccccccccEEEEccccccccccccccccccEEEEEEEEccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccEEEEEEcccccccccccccccccEEEcccccccccccccccccccccccEccccccEEHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEcEEEEHccc
MDGLAKLKKYFhyfgyipdlpsnftddFDDMLESAVKTYQKnfnleptgqldsqtmqhilrprcgnpdivngtttmnsgkptsynatsstnghlhsvghysffpgmprwpsnkrdltyaflpdnqltdEVKNVFATAFDrwseatsltftrtdvyttadirigfftgdhgdgepfdgpmgtlahafsppngrfhldgdenwvitsgtttSISMSAIDLESVAVHEIGHLLglghssvedaimypsissgsrkvelanDDIQGIQAlygnnpnfngssvptdqqrdtsgahgayFLGSCLGLSFFVVAAVLGL
MDGLAKLKKYFHYFGYIPDLPSNFTDDFDDMLESAVKTYQKNFNLEPTGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDLTYAFLPDNQLTDEVKNVFATAfdrwseatsltftrtdvyttADIRIGFFTGDHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALYGNNPNFNGSSVPTDQQRDTSGAHGAYFLGSCLGLSFFVVAAVLGL
MDGLAKLKKYFHYFGYIPDLPSNFTDDFDDMLESAVKTYQKNFNLEPTGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVitsgtttsismsaiDLESVAVHEIGHLLGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALYGNNPNFNGSSVPTDQQRDTSGAHGAYFLGSCLGLSFFVVAAVLGL
*****KLKKYFHYFGYIPDLPSNFTDDFDDMLESAVKTYQKNFN*************************************************LHSVGHYSFFPGMPRWPSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSSVEDAIMYPSI********LANDDIQGIQALYG********************AHGAYFLGSCLGLSFFVVAAVL**
*DGLAKLKKYFHYFGY*****************SAVKTYQKNFNLEPTGQLDSQTMQHILRPRCGNPDIVNGTT*************SSTNGHLHSVGHYSFFPGMPRWPSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALYG***************************GSCLGLSFFVVAAVLGL
MDGLAKLKKYFHYFGYIPDLPSNFTDDFDDMLESAVKTYQKNFNLEPTGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALYGNNPNFNGS**********SGAHGAYFLGSCLGLSFFVVAAVLGL
MDGLAKLKKYFHYFGYIPDLPSNFTDDFDDMLESAVKTYQKNFNLEPTGQLDSQTMQHILRPRCGNPDIVNGTTTMNSG************GHLHSVGHYSFFPGMPRWPSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALYGNNPN********************YFLGSCLGLSFFVVAAVLGL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGLAKLKKYFHYFGYIPDLPSNFTDDFDDMLESAVKTYQKNFNLEPTGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALYGNNPNFNGSSVPTDQQRDTSGAHGAYFLGSCLGLSFFVVAAVLGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query312 2.2.26 [Sep-21-2011]
P29136305 Metalloendoproteinase 1 O no no 0.810 0.829 0.520 2e-72
P79287 483 Matrix metalloproteinase- yes no 0.676 0.436 0.375 1e-36
P57748 482 Matrix metalloproteinase- yes no 0.644 0.417 0.403 4e-35
O18767 481 Matrix metalloproteinase- yes no 0.653 0.424 0.383 4e-35
P28862 477 Stromelysin-1 OS=Mus musc no no 0.724 0.473 0.356 4e-34
O60882 483 Matrix metalloproteinase- yes no 0.653 0.422 0.379 5e-34
Q6Y4Q5 478 Stromelysin-1 OS=Canis fa no no 0.660 0.430 0.390 6e-34
P91953 591 50 kDa hatching enzyme OS N/A no 0.727 0.384 0.364 2e-33
P09237267 Matrilysin OS=Homo sapien no no 0.650 0.760 0.376 2e-33
O55123 476 Stromelysin-2 OS=Mus musc no no 0.657 0.430 0.371 2e-33
>sp|P29136|MEP1_SOYBN Metalloendoproteinase 1 OS=Glycine max PE=1 SV=2 Back     alignment and function desciption
 Score =  273 bits (697), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 174/269 (64%), Gaps = 16/269 (5%)

Query: 3   GLAKLKKYFHYFGYIPDLPSNFTDDFDDMLESAVKTYQKNFNLEPTGQLDSQTMQHILRP 62
           GL+ +K YFH+ GYIP+ P +F D+FDD L SA+KTYQKN+NL  TG+ D  T++ I+ P
Sbjct: 53  GLSNVKNYFHHLGYIPNAP-HFDDNFDDTLVSAIKTYQKNYNLNVTGKFDINTLKQIMTP 111

Query: 63  RCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDLTYAFLP 122
           RCG PDI+     +N+ K TS+   S           Y+FF  MPRW +    LTYAF P
Sbjct: 112 RCGVPDII-----INTNKTTSFGMISD----------YTFFKDMPRWQAGTTQLTYAFSP 156

Query: 123 DNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFDGPMGTL 182
           + +L D  K+  A AF +W+   ++ F  T  Y TA+I+I F + +HGD  PFDGP G L
Sbjct: 157 EPRLDDTFKSAIARAFSKWTPVVNIAFQETTSYETANIKILFASKNHGDPYPFDGPGGIL 216

Query: 183 AHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSSVEDAIM 242
            HAF+P +GR H D DE WV +   T S   SA DLESVAVHEIGHLLGLGHSS   AIM
Sbjct: 217 GHAFAPTDGRCHFDADEYWVASGDVTKSPVTSAFDLESVAVHEIGHLLGLGHSSDLRAIM 276

Query: 243 YPSISSGSRKVELANDDIQGIQALYGNNP 271
           YPSI   +RKV LA DDI GI+ LYG NP
Sbjct: 277 YPSIPPRTRKVNLAQDDIDGIRKLYGINP 305
Specificity similar to that of mammalian matrix metalloproteases. May act against cell wall components.
Glycine max (taxid: 3847)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|P79287|MMP20_PIG Matrix metalloproteinase-20 OS=Sus scrofa GN=MMP20 PE=2 SV=1 Back     alignment and function description
>sp|P57748|MMP20_MOUSE Matrix metalloproteinase-20 OS=Mus musculus GN=Mmp20 PE=2 SV=1 Back     alignment and function description
>sp|O18767|MMP20_BOVIN Matrix metalloproteinase-20 OS=Bos taurus GN=MMP20 PE=1 SV=1 Back     alignment and function description
>sp|P28862|MMP3_MOUSE Stromelysin-1 OS=Mus musculus GN=Mmp3 PE=2 SV=2 Back     alignment and function description
>sp|O60882|MMP20_HUMAN Matrix metalloproteinase-20 OS=Homo sapiens GN=MMP20 PE=1 SV=3 Back     alignment and function description
>sp|Q6Y4Q5|MMP3_CANFA Stromelysin-1 OS=Canis familiaris GN=MMP3 PE=2 SV=1 Back     alignment and function description
>sp|P91953|HE_HEMPU 50 kDa hatching enzyme OS=Hemicentrotus pulcherrimus PE=1 SV=1 Back     alignment and function description
>sp|P09237|MMP7_HUMAN Matrilysin OS=Homo sapiens GN=MMP7 PE=1 SV=1 Back     alignment and function description
>sp|O55123|MMP10_MOUSE Stromelysin-2 OS=Mus musculus GN=Mmp10 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
255558368364 Metalloendoproteinase 1 precursor, putat 0.961 0.824 0.666 1e-119
224122140341 predicted protein [Populus trichocarpa] 0.907 0.829 0.697 1e-114
224136290376 predicted protein [Populus trichocarpa] 0.961 0.797 0.667 1e-113
225424789364 PREDICTED: metalloendoproteinase 1-like 0.913 0.782 0.681 1e-113
147773983364 hypothetical protein VITISV_004096 [Viti 0.913 0.782 0.681 1e-113
98647786365 matrix metalloprotease 1 [Nicotiana taba 0.897 0.767 0.680 1e-112
395627593367 matrix metalloproteinase precursor [Sola 0.903 0.768 0.672 1e-111
289976573364 matrix metalloprotease 1 [Nicotiana bent 0.897 0.769 0.673 1e-111
395759049363 matrix metalloproteinase precursor [Sola 0.932 0.801 0.611 1e-106
110741618378 predicted GPI-anchored protein [Arabidop 0.935 0.772 0.617 1e-106
>gi|255558368|ref|XP_002520211.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] gi|223540703|gb|EEF42266.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 208/312 (66%), Positives = 248/312 (79%), Gaps = 12/312 (3%)

Query: 1   MDGLAKLKKYFHYFGYIPDLPSNFTDDFDDMLESAVKTYQKNFNLEPTGQLDSQTMQHIL 60
           ++GL+KLK YFHYFGYIP+  SNFTDDFDD LESA+KTYQ+NFNL  TG+LD QT+  ++
Sbjct: 59  LEGLSKLKNYFHYFGYIPNTLSNFTDDFDDALESAIKTYQQNFNLNVTGELDEQTLDQLV 118

Query: 61  RPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDLTYAF 120
           RPRCGN DI+NG+TTMNSGK        +T    H+VGHYSFFPG PRWP +KRDLTYAF
Sbjct: 119 RPRCGNADIINGSTTMNSGK------WQTTTTSFHAVGHYSFFPGTPRWPDSKRDLTYAF 172

Query: 121 LPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFDGPMG 180
            P NQLT+  K+VF  AFDRWS    + FT T+ Y  ADIRIGFF+GDHGDGEPFDG +G
Sbjct: 173 WPSNQLTEVEKSVFTRAFDRWSTVIPMNFTETESYNVADIRIGFFSGDHGDGEPFDGVLG 232

Query: 181 TLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSSVEDA 240
           TLAHAFSPP+GRFHLDG+ENWV++   ++S   SA+DLESVAVHEIGHLLGLGHSSVE+A
Sbjct: 233 TLAHAFSPPSGRFHLDGEENWVVSGDISSSTISSAVDLESVAVHEIGHLLGLGHSSVEEA 292

Query: 241 IMYPSISSGSRKVELANDDIQGIQALYGNNPNFNG--SSVPTDQQRDTSGAHGAYFLGS- 297
           IMYP+I S +RK+ELANDDIQGIQ LYG+NPNFNG  SS P+ Q+R+TSGA+ A  L + 
Sbjct: 293 IMYPTIPSRTRKIELANDDIQGIQYLYGSNPNFNGSSSSTPSIQERETSGAYHARSLWAL 352

Query: 298 ---CLGLSFFVV 306
                GLSF ++
Sbjct: 353 GLIAFGLSFLLL 364

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224122140|ref|XP_002318762.1| predicted protein [Populus trichocarpa] gi|222859435|gb|EEE96982.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224136290|ref|XP_002322292.1| predicted protein [Populus trichocarpa] gi|222869288|gb|EEF06419.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225424789|ref|XP_002267298.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147773983|emb|CAN76268.1| hypothetical protein VITISV_004096 [Vitis vinifera] Back     alignment and taxonomy information
>gi|98647786|gb|ABF58910.1| matrix metalloprotease 1 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|395627593|emb|CCH68442.1| matrix metalloproteinase precursor [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|289976573|gb|ADD21635.1| matrix metalloprotease 1 [Nicotiana benthamiana] Back     alignment and taxonomy information
>gi|395759049|emb|CCH68443.1| matrix metalloproteinase precursor [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|110741618|dbj|BAE98757.1| predicted GPI-anchored protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
TAIR|locus:2020548378 MMP "matrix metalloproteinase" 0.996 0.822 0.588 2.7e-100
TAIR|locus:2032467384 AT1G24140 [Arabidopsis thalian 0.929 0.755 0.614 7.4e-98
TAIR|locus:2025891360 AT1G59970 [Arabidopsis thalian 0.926 0.802 0.581 6.5e-90
TAIR|locus:2130928364 AT4G16640 [Arabidopsis thalian 0.939 0.804 0.432 8.8e-63
TAIR|locus:2055605342 AT2G45040 [Arabidopsis thalian 0.903 0.824 0.428 4.6e-57
UNIPROTKB|F1N995 478 MMP10 "Uncharacterized protein 0.567 0.370 0.454 1.1e-40
UNIPROTKB|E1C9E0 472 MMP10 "Uncharacterized protein 0.522 0.345 0.467 4e-39
RGD|1308730 482 Mmp20 "matrix metallopeptidase 0.544 0.352 0.429 1.1e-37
MGI|MGI:97010 477 Mmp3 "matrix metallopeptidase 0.512 0.335 0.416 1.3e-37
UNIPROTKB|P79287 483 MMP20 "Matrix metalloproteinas 0.548 0.354 0.418 1.4e-37
TAIR|locus:2020548 MMP "matrix metalloproteinase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 995 (355.3 bits), Expect = 2.7e-100, P = 2.7e-100
 Identities = 187/318 (58%), Positives = 238/318 (74%)

Query:     1 MDGLAKLKKYFHYFGYIPDLPS-NFTDDFDDMLESAVKTYQKNFNLEPTGQLDSQTMQHI 59
             +DGL ++KKYF  FGYIP+  S NFTDDFDD+L++AV+ YQ NFNL  TG+LD+ T+QHI
Sbjct:    56 VDGLYRIKKYFQRFGYIPETFSGNFTDDFDDILKAAVELYQTNFNLNVTGELDALTIQHI 115

Query:    60 LRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDLTYA 119
             + PRCGNPD+VNGT+ M+ G+  ++    S   HLH+V  Y+ FPG PRWP N+RDLTYA
Sbjct:   116 VIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRT-HLHAVKRYTLFPGEPRWPRNRRDLTYA 174

Query:   120 FLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFDGPM 179
             F P N LT+EVK+VF+ AF RWS+ T+L FT ++ ++T+DI IGF+TGDHGDGEPFDG +
Sbjct:   175 FDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSESFSTSDITIGFYTGDHGDGEPFDGVL 234

Query:   180 GTLAHAFSPPNGRFHLDGDENWVXXXXXXXXXXXXXX-DLESVAVHEIGHLLGLGHSSVE 238
             GTLAHAFSPP+G+FHLD DENWV               DLESVAVHEIGHLLGLGHSSVE
Sbjct:   235 GTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLGLGHSSVE 294

Query:   239 DAIMYPSISSGSRKVELANDDIQGIQALYGNNPNFNGSSVP---TDQQRDTSGAHGAYFL 295
             ++IMYP+I++G RKV+L NDD++GIQ LYG NPNFNG++ P   T  QRDT G   A+ +
Sbjct:   295 ESIMYPTITTGKRKVDLTNDDVEGIQYLYGANPNFNGTTSPPSTTKHQRDTGGFSAAWRI 354

Query:   296 -GSCLGLSFFVVAAVLGL 312
              GS       ++ + +GL
Sbjct:   355 DGSSRSTIVSLLLSTVGL 372
GO:0004222 "metalloendopeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0008237 "metallopeptidase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0031012 "extracellular matrix" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
TAIR|locus:2032467 AT1G24140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025891 AT1G59970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130928 AT4G16640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055605 AT2G45040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1N995 MMP10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C9E0 MMP10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1308730 Mmp20 "matrix metallopeptidase 20" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97010 Mmp3 "matrix metallopeptidase 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P79287 MMP20 "Matrix metalloproteinase-20" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.240.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XII.1614.1
hypothetical protein (341 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
cd04278157 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, 4e-70
pfam00413159 pfam00413, Peptidase_M10, Matrixin 8e-70
smart00235139 smart00235, ZnMc, Zinc-dependent metalloprotease 7e-28
cd04279156 cd04279, ZnMc_MMP_like_1, Zinc-dependent metallopr 2e-12
cd04277186 cd04277, ZnMc_serralysin_like, Zinc-dependent meta 3e-12
pfam0147157 pfam01471, PG_binding_1, Putative peptidoglycan bi 9e-11
cd04268165 cd04268, ZnMc_MMP_like, Zinc-dependent metalloprot 5e-09
cd00203167 cd00203, ZnMc, Zinc-dependent metalloprotease 2e-07
cd11375173 cd11375, Peptidase_M54, Peptidase family M54, also 1e-04
cd04327198 cd04327, ZnMc_MMP_like_3, Zinc-dependent metallopr 3e-04
COG1913181 COG1913, COG1913, Predicted Zn-dependent proteases 0.002
>gnl|CDD|239805 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information 
 Score =  214 bits (547), Expect = 4e-70
 Identities = 82/165 (49%), Positives = 93/165 (56%), Gaps = 12/165 (7%)

Query: 108 RWPSNKRDLTYAFLPDNQL--TDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFF 165
           +W  +K +LTY  L        D+V+   A AF  WS+ T LTF        ADIRI F 
Sbjct: 1   KW--SKTNLTYRILNYPPDLPRDDVRRAIARAFRVWSDVTPLTFREVTSGQEADIRISFA 58

Query: 166 TGDHGDGEPFDGPMGTLAHAFSP--PNGRFHLDGDENWVITSGTTTSISMSAIDLESVAV 223
            G+HGDG PFDGP GTLAHAF P    G  H D DE W      T        DL SVA 
Sbjct: 59  RGNHGDGYPFDGPGGTLAHAFFPGGIGGDIHFDDDEQW------TLGSDSGGTDLFSVAA 112

Query: 224 HEIGHLLGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALYG 268
           HEIGH LGLGHSS  D+IMYP       K +L+ DDI+GIQALYG
Sbjct: 113 HEIGHALGLGHSSDPDSIMYPYYQGPVPKFKLSQDDIRGIQALYG 157

MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases). Length = 157
>gnl|CDD|215908 pfam00413, Peptidase_M10, Matrixin Back     alignment and domain information
>gnl|CDD|214576 smart00235, ZnMc, Zinc-dependent metalloprotease Back     alignment and domain information
>gnl|CDD|239806 cd04279, ZnMc_MMP_like_1, Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>gnl|CDD|239804 cd04277, ZnMc_serralysin_like, Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>gnl|CDD|216518 pfam01471, PG_binding_1, Putative peptidoglycan binding domain Back     alignment and domain information
>gnl|CDD|239796 cd04268, ZnMc_MMP_like, Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>gnl|CDD|238124 cd00203, ZnMc, Zinc-dependent metalloprotease Back     alignment and domain information
>gnl|CDD|213029 cd11375, Peptidase_M54, Peptidase family M54, also called archaemetzincins or archaelysins Back     alignment and domain information
>gnl|CDD|239819 cd04327, ZnMc_MMP_like_3, Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information
>gnl|CDD|224825 COG1913, COG1913, Predicted Zn-dependent proteases [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 312
KOG1565 469 consensus Gelatinase A and related matrix metallop 100.0
cd04278157 ZnMc_MMP Zinc-dependent metalloprotease, matrix me 100.0
PF00413154 Peptidase_M10: Matrixin This Prosite motif covers 100.0
cd04279156 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MM 99.95
cd04268165 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_ 99.9
smart00235140 ZnMc Zinc-dependent metalloprotease. Neutral zinc 99.9
cd04277186 ZnMc_serralysin_like Zinc-dependent metalloproteas 99.89
cd04327198 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MM 99.74
cd00203167 ZnMc Zinc-dependent metalloprotease. This super-fa 99.72
cd04276197 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MM 99.56
cd04280180 ZnMc_astacin_like Zinc-dependent metalloprotease, 99.52
PF12388211 Peptidase_M57: Dual-action HEIGH metallo-peptidase 99.51
cd04281200 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1 99.47
) family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01400">PF01400191 Astacin: Astacin (Peptidase family M12A) This Pros 99.44
cd04282230 ZnMc_meprin Zinc-dependent metalloprotease, meprin 99.33
cd04283182 ZnMc_hatching_enzyme Zinc-dependent metalloproteas 99.32
KOG3714 411 consensus Meprin A metalloprotease [Posttranslatio 99.26
PF0147157 PG_binding_1: Putative peptidoglycan binding domai 99.25
COG5549236 Predicted Zn-dependent protease [Posttranslational 98.9
PF02031132 Peptidase_M7: Streptomyces extracellular neutral p 98.9
TIGR02869201 spore_SleB spore cortex-lytic enzyme. Members of t 97.75
cd04267192 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADA 97.74
cd04273207 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, A 97.71
PF13583206 Reprolysin_4: Metallo-peptidase family M12B Reprol 97.7
PF11350203 DUF3152: Protein of unknown function (DUF3152); In 97.68
PF05572154 Peptidase_M43: Pregnancy-associated plasma protein 97.44
PF13574173 Reprolysin_2: Metallo-peptidase family M12B Reprol 97.42
COG1913181 Predicted Zn-dependent proteases [General function 97.33
cd04275225 ZnMc_pappalysin_like Zinc-dependent metalloproteas 97.3
PF13688196 Reprolysin_5: Metallo-peptidase family M12; PDB: 2 97.25
PRK13267179 archaemetzincin-like protein; Reviewed 97.13
PF13582124 Reprolysin_3: Metallo-peptidase family M12B Reprol 97.13
PRK10594608 murein L,D-transpeptidase; Provisional 96.98
PF07998194 Peptidase_M54: Peptidase family M54; InterPro: IPR 96.92
cd04271228 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, A 96.87
cd04269194 ZnMc_adamalysin_II_like Zinc-dependent metalloprot 96.81
cd04270244 ZnMc_TACE_like Zinc-dependent metalloprotease; TAC 95.99
PF01421199 Reprolysin: Reprolysin (M12B) family zinc metallop 95.88
cd04272220 ZnMc_salivary_gland_MPs Zinc-dependent metalloprot 95.51
COG3409185 Putative peptidoglycan-binding domain-containing p 95.46
COG3023257 ampD N-acetyl-anhydromuramyl-L-alanine amidase [Ce 95.31
COG2989561 Uncharacterized protein conserved in bacteria [Fun 94.96
KOG4525 614 consensus Jacalin-like lectin domain-containing pr 94.92
PF10462305 Peptidase_M66: Peptidase M66; InterPro: IPR019503 94.62
PF05548314 Peptidase_M11: Gametolysin peptidase M11; InterPro 94.53
PF12044423 Metallopep: Putative peptidase family; InterPro: I 93.37
TIGR03296286 M6dom_TIGR03296 M6 family metalloprotease domain. 93.15
PF11150213 DUF2927: Protein of unknown function (DUF2927); In 91.94
PTZ00337 567 surface protease GP63; Provisional 91.86
PF01457 521 Peptidase_M8: Leishmanolysin This Prosite motif co 91.44
PF0882374 PG_binding_2: Putative peptidoglycan binding domai 91.36
COG3824136 Predicted Zn-dependent protease [General function 90.99
PTZ00257 622 Glycoprotein GP63 (leishmanolysin); Provisional 90.64
PF04298222 Zn_peptidase_2: Putative neutral zinc metallopepti 90.2
PF05547 645 Peptidase_M6: Immune inhibitor A peptidase M6; Int 88.11
COG2738226 Predicted Zn-dependent protease [General function 87.33
PF09471264 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019 87.01
KOG3607 716 consensus Meltrins, fertilins and related Zn-depen 85.4
KOG3658 764 consensus Tumor necrosis factor-alpha-converting e 83.2
PF0626297 DUF1025: Possibl zinc metallo-peptidase; InterPro: 83.07
>KOG1565 consensus Gelatinase A and related matrix metalloproteases [Posttranslational modification, protein turnover, chaperones; Extracellular structures] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-56  Score=438.18  Aligned_cols=235  Identities=47%  Similarity=0.793  Sum_probs=210.2

Q ss_pred             ChHHHHHHHHhcCCCCCCCCCCCCcchHHHHHHHHHHHHhcCCCCCCCCCHHHHHHhcCCCCCCCCCCCCccccCCCCCC
Q 021444            3 GLAKLKKYFHYFGYIPDLPSNFTDDFDDMLESAVKTYQKNFNLEPTGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPT   82 (312)
Q Consensus         3 ~~~~~~~yL~~fGYl~~~~~~~~~~~~~~~~~Ai~~fQ~~~gLpvTG~lD~~T~~~M~~pRCG~pD~~~~~~~~~~~~~~   82 (312)
                      ++..++.||++|||+++.+...+...++.+++||+.||++++|++||++|.+|++.|++|||||||.             
T Consensus        29 ~~~~~~~yl~~~~y~~~~~~~~~~~~~~~~~~al~~~q~~~~l~~tG~lD~~Tl~~m~~prCgvpd~-------------   95 (469)
T KOG1565|consen   29 DKVALQDYLECYGYLPPTDLTATRASQNVLEDALKMMQDFFGLPVTGKLDNATLALMNKPRCGVPDG-------------   95 (469)
T ss_pred             chhHHHHHhhhcccCCCccccccccCchhhHHHHHhhhhhcCccccCCcchhhhhhccCCCcCCCCC-------------
Confidence            3577899999999998765432222578999999999999999999999999999999999999992             


Q ss_pred             CCCCCCCCCCCcccccccccCCCCCCCCCCCCceEEeecCC-CCCh-HHHHHHHHHHHHHHhhcccceEEEcccCCcccE
Q 021444           83 SYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDLTYAFLPD-NQLT-DEVKNVFATAFDRWSEATSLTFTRTDVYTTADI  160 (312)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~kW~~~~~~LtY~i~~~-~~~~-~~~~~~i~~A~~~Ws~~s~l~F~ev~~~~~aDI  160 (312)
                                      +|++++++.||  ++.+|||+|.++ +.++ .+++.++++||+.|+++++++|.|+.....|||
T Consensus        96 ----------------~~~~~~~~~kW--~k~~lT~ri~n~~~~l~~~~vr~~~~~Af~~Ws~vtpl~f~e~~~~~~aDi  157 (469)
T KOG1565|consen   96 ----------------RYRYFPGKPKW--NKEHLTYRIKNYTPYLPQAEVRCAKSEAFKLWSDVTPLTFQEVKEEGEADI  157 (469)
T ss_pred             ----------------ccccCcccCcc--cccccceeccccCCCCCHHHHHHHHHHHHhhcccCCCCccccCCCCCCCce
Confidence                            25567788999  788999999987 3344 899999999999999999999999996679999


Q ss_pred             EEEeeecCCCCCCCcCCCCCcceeeeCCC---CCceEecCCCCceecCCCccccCCccccchhhhhhhhhhhcCCCCCCC
Q 021444          161 RIGFFTGDHGDGEPFDGPMGTLAHAFSPP---NGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSSV  237 (312)
Q Consensus       161 ~I~f~~~~hgd~~~fdG~gg~lAhA~~P~---~G~ihfd~~e~wt~~~~~~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~  237 (312)
                      +|.|..+.|||++||||++|+|||||+|+   .|++|||++|.|++.       ...+++++.||+|||||+|||.||.+
T Consensus       158 ~i~F~~~~h~d~~PFDG~~g~laHAf~Pg~~~~G~~hfD~dE~Wt~~-------~~~g~~l~~Va~HEiGH~LGL~HS~~  230 (469)
T KOG1565|consen  158 RISFFPGDHGDGFPFDGPGGVLAHAFFPGPGIGGDLHFDKDETWTYG-------DSNGVDLFLVAAHEIGHALGLGHSSD  230 (469)
T ss_pred             eeeeeccCCCCCCcccCCCCceecccCCCCCCCCccccCcccceecc-------CCccchhHHHhhhhcccccccCCCCC
Confidence            99999999999999999999999999994   689999999999995       13488999999999999999999999


Q ss_pred             CCCccccccCCCCCcCCCCHHHHHHHHHHhCCCCCCCC
Q 021444          238 EDAIMYPSISSGSRKVELANDDIQGIQALYGNNPNFNG  275 (312)
Q Consensus       238 ~~sIM~p~y~~~~~~~~L~~dDi~~Iq~LYG~~~~~~~  275 (312)
                      +++||||+|++...++.|+.|||.|||.|||.+++...
T Consensus       231 ~~aiM~P~y~~~~~~~~L~~DDv~giq~lYG~~~~~~~  268 (469)
T KOG1565|consen  231 PDAIMYPFYQPDSGNFDLSQDDVRGIQHLYGGPPRDYF  268 (469)
T ss_pred             cccccccccccCCCCcccChhhhhhhHHHhCCCccccc
Confidence            99999999997667889999999999999999888643

>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>PF00413 Peptidase_M10: Matrixin This Prosite motif covers only the active site Back     alignment and domain information
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>smart00235 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information
>cd00203 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2 Back     alignment and domain information
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site Back     alignment and domain information
>PF12388 Peptidase_M57: Dual-action HEIGH metallo-peptidase; InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57 Back     alignment and domain information
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily Back     alignment and domain information
>PF01400 Astacin: Astacin (Peptidase family M12A) This Prosite motif covers only the active site Back     alignment and domain information
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily Back     alignment and domain information
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily Back     alignment and domain information
>KOG3714 consensus Meprin A metalloprotease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01471 PG_binding_1: Putative peptidoglycan binding domain; InterPro: IPR002477 This entry represents peptidoglycan binding domain (PGBD), as well as related domains that share the same structure Back     alignment and domain information
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02031 Peptidase_M7: Streptomyces extracellular neutral proteinase (M7) family; InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02869 spore_SleB spore cortex-lytic enzyme Back     alignment and domain information
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup Back     alignment and domain information
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup Back     alignment and domain information
>PF13583 Reprolysin_4: Metallo-peptidase family M12B Reprolysin-like Back     alignment and domain information
>PF11350 DUF3152: Protein of unknown function (DUF3152); InterPro: IPR022603 This entry represents Actinobacteria proteins of unknown function Back     alignment and domain information
>PF05572 Peptidase_M43: Pregnancy-associated plasma protein-A; InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13574 Reprolysin_2: Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A Back     alignment and domain information
>COG1913 Predicted Zn-dependent proteases [General function prediction only] Back     alignment and domain information
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily Back     alignment and domain information
>PF13688 Reprolysin_5: Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B Back     alignment and domain information
>PRK13267 archaemetzincin-like protein; Reviewed Back     alignment and domain information
>PF13582 Reprolysin_3: Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C Back     alignment and domain information
>PRK10594 murein L,D-transpeptidase; Provisional Back     alignment and domain information
>PF07998 Peptidase_M54: Peptidase family M54; InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup Back     alignment and domain information
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily Back     alignment and domain information
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily Back     alignment and domain information
>PF01421 Reprolysin: Reprolysin (M12B) family zinc metalloprotease This Prosite motif covers only the active site Back     alignment and domain information
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs Back     alignment and domain information
>COG3409 Putative peptidoglycan-binding domain-containing protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3023 ampD N-acetyl-anhydromuramyl-L-alanine amidase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2989 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4525 consensus Jacalin-like lectin domain-containing protein [General function prediction only] Back     alignment and domain information
>PF10462 Peptidase_M66: Peptidase M66; InterPro: IPR019503 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05548 Peptidase_M11: Gametolysin peptidase M11; InterPro: IPR008752 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF12044 Metallopep: Putative peptidase family; InterPro: IPR021917 This family of proteins is functionally uncharacterised Back     alignment and domain information
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain Back     alignment and domain information
>PF11150 DUF2927: Protein of unknown function (DUF2927); InterPro: IPR021323 This family is conserved in Proteobacteria Back     alignment and domain information
>PTZ00337 surface protease GP63; Provisional Back     alignment and domain information
>PF01457 Peptidase_M8: Leishmanolysin This Prosite motif covers only the active site Back     alignment and domain information
>PF08823 PG_binding_2: Putative peptidoglycan binding domain; InterPro: IPR014927 This entry may be a peptidoglycan binding domain Back     alignment and domain information
>COG3824 Predicted Zn-dependent protease [General function prediction only] Back     alignment and domain information
>PTZ00257 Glycoprotein GP63 (leishmanolysin); Provisional Back     alignment and domain information
>PF04298 Zn_peptidase_2: Putative neutral zinc metallopeptidase; InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases Back     alignment and domain information
>PF05547 Peptidase_M6: Immune inhibitor A peptidase M6; InterPro: IPR008757 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2738 Predicted Zn-dependent protease [General function prediction only] Back     alignment and domain information
>PF09471 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3607 consensus Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3658 consensus Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases [Extracellular structures] Back     alignment and domain information
>PF06262 DUF1025: Possibl zinc metallo-peptidase; InterPro: IPR010428 This is a family of bacterial protein with undetermined function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
1slm_A255 Crystal Structure Of Fibroblast Stromelysin-1: The 3e-33
1su3_A 450 X-Ray Structure Of Human Prommp-1: New Insights Int 2e-31
2j0t_A170 Crystal Structure Of The Catalytic Domain Of Mmp-1 4e-26
3ayk_A169 Catalytic Fragment Of Human Fibroblast Collagenase 4e-26
2ddy_A173 Solution Structure Of Matrilysin (Mmp-7) Complexed 5e-26
2y6d_A174 The Discovery Of Mmp7 Inhibitors Exploiting A Novel 5e-26
1mmp_A170 Matrilysin Complexed With Carboxylate Inhibitor Len 5e-26
1cgl_A169 Structure Of The Catalytic Domain Of Fibroblast Col 7e-26
1cge_A168 Crystal Structures Of Recombinant 19-Kda Human Fibr 8e-26
2clt_A 367 Crystal Structure Of The Active Form (Full-Length) 1e-25
1fbl_A 370 Structure Of Full-Length Porcine Synovial Collagena 2e-25
1bzs_A165 Crystal Structure Of Mmp8 Complexed With Hmr2909 Le 2e-25
1cxv_A164 Structure Of Recombinant Mouse Collagenase-3 (Mmp-1 2e-25
1kbc_A164 Procarboxypeptidase Ternary Complex Length = 164 2e-25
1jaq_A163 Complex Of 1-Hydroxylamine-2-Isobutylmalonyl-Ala-Gl 2e-25
1cgf_A162 Crystal Structures Of Recombinant 19-Kda Human Fibr 2e-25
3shi_A156 Crystal Structure Of Human Mmp1 Catalytic Domain At 3e-25
2xs3_A166 Structure Of Karilysin Catalytic Mmp Domain Length 5e-25
2xs4_A167 Structure Of Karilysin Catalytic Mmp Domain In Comp 5e-25
1biw_A173 Design And Synthesis Of Conformationally-Constraine 6e-25
2d1o_A171 Stromelysin-1 (Mmp-3) Complexed To A Hydroxamic Aci 6e-25
1mnc_A163 Structure Of Human Neutrophil Collagenase Reveals L 6e-25
1ums_A174 Stromelysin-1 Catalytic Domain With Hydrophobic Inh 6e-25
3oho_A169 Catalytic Domain Of Stromelysin-1 In Complex With N 7e-25
1caq_A168 X-Ray Structure Of Human Stromelysin Catalytic Doma 9e-25
2y6c_A165 The Discovery Of Mmp7 Inhibitors Exploiting A Novel 1e-24
3kec_A167 Crystal Structure Of Human Mmp-13 Complexed With A 1e-24
3tt4_A159 Human Mmp8 In Complex With L-Glutamate Motif Inhibi 1e-24
3kry_A164 Crystal Structure Of Mmp-13 In Complex With Sc-7808 1e-24
1fls_A165 Solution Structure Of The Catalytic Fragment Of Hum 1e-24
1eub_A171 Solution Structure Of The Catalytic Domain Of Human 1e-24
2ow9_A170 Crystal Structure Analysis Of The Mmp13 Catalytic D 1e-24
2d1n_A166 Collagenase-3 (Mmp-13) Complexed To A Hydroxamic Ac 1e-24
456c_A168 Crystal Structure Of Collagenase-3 (Mmp-13) Complex 1e-24
1c8t_A167 Human Stromelysin-1 (E202q) Catalytic Domain Comple 1e-24
4a7b_A169 Mmp13 In Complex With A Novel Selective Non Zinc Bi 2e-24
1usn_A165 Crystal Structure Of The Catalytic Domain Of Human 2e-24
1b8y_A167 X-Ray Structure Of Human Stromelysin Catalytic Doma 2e-24
1a86_A158 Mmp8 With Malonic And Aspartic Acid Based Inhibitor 3e-24
2jsd_A160 Solution Structure Of Mmp20 Complexed With Nngh Len 3e-24
966c_A157 Crystal Structure Of Fibroblast Collagenase-1 Compl 3e-24
1uea_A173 Mmp-3TIMP-1 Complex Length = 173 4e-24
1q3a_A165 Crystal Structure Of The Catalytic Domain Of Human 5e-24
3ljz_A164 Crystal Structure Of Human Mmp-13 Complexed With An 6e-24
1hov_A163 Solution Structure Of A Catalytic Domain Of Mmp-2 C 9e-24
3v96_B165 Complex Of Matrix Metalloproteinase-10 Catalytic Do 1e-23
3ayu_A167 Crystal Structure Of Mmp-2 Active Site Mutant In Co 1e-23
1hfs_A160 Crystal Structure Of The Catalytic Domain Of Human 5e-23
2jnp_A161 Solution Structure Of Matrix Metalloproteinase 3 (M 6e-23
1qia_A162 Crystal Structure Of Stromelysin Catalytic Domain L 1e-22
1qic_A161 Crystal Structure Of Stromelysin Catalytic Domain L 2e-22
1hv5_A165 Crystal Structure Of The Stromelysin-3 (Mmp-11) Cat 4e-22
1eak_A 421 Catalytic Domain Of Prommp-2 E404q Mutant Length = 7e-22
1eak_A421 Catalytic Domain Of Prommp-2 E404q Mutant Length = 9e-07
1ck7_A 631 Gelatinase A (Full-Length) Length = 631 1e-21
1ck7_A 631 Gelatinase A (Full-Length) Length = 631 5e-07
1qib_A161 Crystal Structure Of Gelatinase A Catalytic Domain 2e-21
1jiz_A166 Crystal Structure Analysis Of Human Macrophage Elas 2e-20
1gkc_A163 Mmp9-inhibitor Complex Length = 163 2e-20
2k2g_A165 Solution Structure Of The Wild-Type Catalytic Domai 3e-20
2z2d_A164 Solution Structure Of Human Macrophage Elastase (Mm 3e-20
1gkd_A163 Mmp9 Active Site Mutant-Inhibitor Complex Length = 5e-20
2ovx_A159 Mmp-9 Active Site Mutant With Barbiturate Inhibitor 6e-20
2poj_A164 Nmr Solution Structure Of The Inhibitor-Free State 1e-19
3ba0_A 365 Crystal Structure Of Full-Length Human Mmp-12 Lengt 2e-19
1os2_A165 Ternary Enzyme-Product-Inhibitor Complexes Of Human 2e-19
3f15_A158 Crystal Structure Of The Catalytic Domain Of Human 2e-19
1rmz_A159 Crystal Structure Of The Catalytic Domain Of Human 3e-19
1ros_A163 Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dio 3e-19
2wo8_A164 Mmp12 Complex With A Beta Hydroxy Carboxylic Acid L 3e-19
1utt_A159 Crystal Structure Of Mmp-12 Complexed To 2- (1,3-Di 3e-19
2k9c_A152 Paramagnetic Shifts In Solid-State Nmr Of Proteins 5e-19
2w0d_A164 Does A Fast Nuclear Magnetic Resonance Spectroscopy 1e-18
1jk3_A158 Crystal Structure Of Human Mmp-12 (Macrophage Elast 2e-18
4gr8_A152 Crystal Structure Of The Catalytic Domain Of Human 2e-18
1rm8_A169 Crystal Structure Of The Catalytic Domain Of Mmp-16 9e-18
3ma2_D181 Complex Membrane Type-1 Matrix Metalloproteinase (M 1e-15
1bqq_M174 Crystal Structure Of The Mt1-Mmp--Timp-2 Complex Le 4e-15
1l6j_A 425 Crystal Structure Of Human Matrix Metalloproteinase 1e-14
1l6j_A425 Crystal Structure Of Human Matrix Metalloproteinase 3e-06
>pdb|1SLM|A Chain A, Crystal Structure Of Fibroblast Stromelysin-1: The C-Truncated Human Proenzyme Length = 255 Back     alignment and structure 
Iteration: 1

 Score =  138 bits (348), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 121/248 (48%), Gaps = 50/248 (20%)
Query: 34  SAVKTYQKNFNLEPTGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGH 93
             ++  QK   LE TG+LDS T++ + +PRCG PD                         
Sbjct: 45  KKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPD------------------------- 79
Query: 94  LHSVGHYSFFPGMPRWPSNKRDLTYAFL---PDNQLTDEVKNVFATAFDRWSEATSLTFT 150
              VGH+  FPG+P+W   K  LTY  +   PD    D V +    A   W E T LTF+
Sbjct: 80  ---VGHFRTFPGIPKW--RKTHLTYRIVNYTPDLP-KDAVDSAVEKALKVWEEVTPLTFS 133
Query: 151 RTDVYT-TADIRIGFFTGDHGDGEPFDGPMGTLAHAFSP---PNGRFHLDGDENWVXXXX 206
           R  +Y   ADI I F   +HGD  PFDGP   LAHA++P    NG  H D DE W     
Sbjct: 134 R--LYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWT---- 187
Query: 207 XXXXXXXXXXDLESVAVHEIGHLLGLGHSSVEDAIMYPSISSGS--RKVELANDDIQGIQ 264
                     +L  VA HEIGH LGL HS+  +A+MYP   S +   +  L+ DDI GIQ
Sbjct: 188 ----KDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQ 243
Query: 265 ALYGNNPN 272
           +LYG  P+
Sbjct: 244 SLYGPPPD 251
>pdb|1SU3|A Chain A, X-Ray Structure Of Human Prommp-1: New Insights Into Collagenase Action Length = 450 Back     alignment and structure
>pdb|2J0T|A Chain A, Crystal Structure Of The Catalytic Domain Of Mmp-1 In Complex With The Inhibitory Domain Of Timp-1 Length = 170 Back     alignment and structure
>pdb|3AYK|A Chain A, Catalytic Fragment Of Human Fibroblast Collagenase Complexed With Cgs-27023a, Nmr, Minimized Average Structure Length = 169 Back     alignment and structure
>pdb|2DDY|A Chain A, Solution Structure Of Matrilysin (Mmp-7) Complexed To Constraint Conformational Sulfonamide Inhibitor Length = 173 Back     alignment and structure
>pdb|2Y6D|A Chain A, The Discovery Of Mmp7 Inhibitors Exploiting A Novel Selectivity Trigger Length = 174 Back     alignment and structure
>pdb|1MMP|A Chain A, Matrilysin Complexed With Carboxylate Inhibitor Length = 170 Back     alignment and structure
>pdb|1CGL|A Chain A, Structure Of The Catalytic Domain Of Fibroblast Collagenase Complexed With An Inhibitor Length = 169 Back     alignment and structure
>pdb|1CGE|A Chain A, Crystal Structures Of Recombinant 19-Kda Human Fibroblast Collagenase Complexed To Itself Length = 168 Back     alignment and structure
>pdb|2CLT|A Chain A, Crystal Structure Of The Active Form (Full-Length) Of Human Fibroblast Collagenase. Length = 367 Back     alignment and structure
>pdb|1FBL|A Chain A, Structure Of Full-Length Porcine Synovial Collagenase (Mmp1) Reveals A C-Terminal Domain Containing A Calcium-Linked, Four-Bladed Beta- Propeller Length = 370 Back     alignment and structure
>pdb|1BZS|A Chain A, Crystal Structure Of Mmp8 Complexed With Hmr2909 Length = 165 Back     alignment and structure
>pdb|1CXV|A Chain A, Structure Of Recombinant Mouse Collagenase-3 (Mmp-13) Length = 164 Back     alignment and structure
>pdb|1KBC|A Chain A, Procarboxypeptidase Ternary Complex Length = 164 Back     alignment and structure
>pdb|1JAQ|A Chain A, Complex Of 1-Hydroxylamine-2-Isobutylmalonyl-Ala-Gly-Nh2 With The Catalytic Domain Of Matrix Metallo Proteinase-8 (Met80 Form) Length = 163 Back     alignment and structure
>pdb|1CGF|A Chain A, Crystal Structures Of Recombinant 19-Kda Human Fibroblast Collagenase Complexed To Itself Length = 162 Back     alignment and structure
>pdb|3SHI|A Chain A, Crystal Structure Of Human Mmp1 Catalytic Domain At 2.2 A Resolution Length = 156 Back     alignment and structure
>pdb|2XS3|A Chain A, Structure Of Karilysin Catalytic Mmp Domain Length = 166 Back     alignment and structure
>pdb|2XS4|A Chain A, Structure Of Karilysin Catalytic Mmp Domain In Complex With Magnesium Length = 167 Back     alignment and structure
>pdb|1BIW|A Chain A, Design And Synthesis Of Conformationally-Constrained Mmp Inhibitors Length = 173 Back     alignment and structure
>pdb|2D1O|A Chain A, Stromelysin-1 (Mmp-3) Complexed To A Hydroxamic Acid Inhibitor Length = 171 Back     alignment and structure
>pdb|1MNC|A Chain A, Structure Of Human Neutrophil Collagenase Reveals Large S1' Specificity Pocket Length = 163 Back     alignment and structure
>pdb|1UMS|A Chain A, Stromelysin-1 Catalytic Domain With Hydrophobic Inhibitor Bound, Ph 7.0, 32oc, 20 Mm Cacl2, 15% Acetonitrile; Nmr Ensemble Of 20 Structures Length = 174 Back     alignment and structure
>pdb|3OHO|A Chain A, Catalytic Domain Of Stromelysin-1 In Complex With N-Hydroxy-2-(4- Methylphenylsulfonamido)acetamide Length = 169 Back     alignment and structure
>pdb|1CAQ|A Chain A, X-Ray Structure Of Human Stromelysin Catalytic Domain Complexes With Non-Peptide Inhibitors: Implication For Inhibitor Selectivity Length = 168 Back     alignment and structure
>pdb|2Y6C|A Chain A, The Discovery Of Mmp7 Inhibitors Exploiting A Novel Selectivity Trigger Length = 165 Back     alignment and structure
>pdb|3KEC|A Chain A, Crystal Structure Of Human Mmp-13 Complexed With A Phenyl-2h-Tetrazole Compound Length = 167 Back     alignment and structure
>pdb|3TT4|A Chain A, Human Mmp8 In Complex With L-Glutamate Motif Inhibitor Length = 159 Back     alignment and structure
>pdb|3KRY|A Chain A, Crystal Structure Of Mmp-13 In Complex With Sc-78080 Length = 164 Back     alignment and structure
>pdb|1FLS|A Chain A, Solution Structure Of The Catalytic Fragment Of Human Collagenase-3 (Mmp-13) Complexed With A Hydroxamic Acid Inhibitor Length = 165 Back     alignment and structure
>pdb|1EUB|A Chain A, Solution Structure Of The Catalytic Domain Of Human Collagenase-3 (Mmp-13) Complexed To A Potent Non-Peptidic Sulfonamide Inhibitor Length = 171 Back     alignment and structure
>pdb|2OW9|A Chain A, Crystal Structure Analysis Of The Mmp13 Catalytic Domain In Complex With Specific Inhibitor Length = 170 Back     alignment and structure
>pdb|2D1N|A Chain A, Collagenase-3 (Mmp-13) Complexed To A Hydroxamic Acid Inhibitor Length = 166 Back     alignment and structure
>pdb|456C|A Chain A, Crystal Structure Of Collagenase-3 (Mmp-13) Complexed To A Diphenyl-Ether Sulphone Based Hydroxamic Acid Length = 168 Back     alignment and structure
>pdb|1C8T|A Chain A, Human Stromelysin-1 (E202q) Catalytic Domain Complexed With Ro-26-2812 Length = 167 Back     alignment and structure
>pdb|4A7B|A Chain A, Mmp13 In Complex With A Novel Selective Non Zinc Binding Inhibitor Cmpd22 Length = 169 Back     alignment and structure
>pdb|1USN|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With Thiadiazole Inhibitor Pnu-142372 Length = 165 Back     alignment and structure
>pdb|1B8Y|A Chain A, X-Ray Structure Of Human Stromelysin Catalytic Domain Complexed With Non-Peptide Inhibitors: Implications For Inhibitor Selectivity Length = 167 Back     alignment and structure
>pdb|1A86|A Chain A, Mmp8 With Malonic And Aspartic Acid Based Inhibitor Length = 158 Back     alignment and structure
>pdb|2JSD|A Chain A, Solution Structure Of Mmp20 Complexed With Nngh Length = 160 Back     alignment and structure
>pdb|966C|A Chain A, Crystal Structure Of Fibroblast Collagenase-1 Complexed To A Diphenyl-Ether Sulphone Based Hydroxamic Acid Length = 157 Back     alignment and structure
>pdb|1UEA|A Chain A, Mmp-3TIMP-1 Complex Length = 173 Back     alignment and structure
>pdb|1Q3A|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Matrix Metalloproteinase 10 Length = 165 Back     alignment and structure
>pdb|3LJZ|A Chain A, Crystal Structure Of Human Mmp-13 Complexed With An Amino-2-Indanol Compound Length = 164 Back     alignment and structure
>pdb|1HOV|A Chain A, Solution Structure Of A Catalytic Domain Of Mmp-2 Complexed With Sc-74020 Length = 163 Back     alignment and structure
>pdb|3V96|B Chain B, Complex Of Matrix Metalloproteinase-10 Catalytic Domain (Mmp-10cd) With Tissue Inhibitor Of Metalloproteinases-1 (Timp-1) Length = 165 Back     alignment and structure
>pdb|3AYU|A Chain A, Crystal Structure Of Mmp-2 Active Site Mutant In Complex With App- Drived Decapeptide Inhibitor Length = 167 Back     alignment and structure
>pdb|1HFS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With The N-Carboxy-Alkyl Inhibitor L-764,004 Length = 160 Back     alignment and structure
>pdb|2JNP|A Chain A, Solution Structure Of Matrix Metalloproteinase 3 (Mmp-3) In The Presence Of N-Isobutyl-N-[4- Methoxyphenylsulfonyl]glycyl Hydroxamic Acid (Nngh) Length = 161 Back     alignment and structure
>pdb|1QIA|A Chain A, Crystal Structure Of Stromelysin Catalytic Domain Length = 162 Back     alignment and structure
>pdb|1QIC|A Chain A, Crystal Structure Of Stromelysin Catalytic Domain Length = 161 Back     alignment and structure
>pdb|1HV5|A Chain A, Crystal Structure Of The Stromelysin-3 (Mmp-11) Catalytic Domain Complexed With A Phosphinic Inhibitor Length = 165 Back     alignment and structure
>pdb|1EAK|A Chain A, Catalytic Domain Of Prommp-2 E404q Mutant Length = 421 Back     alignment and structure
>pdb|1EAK|A Chain A, Catalytic Domain Of Prommp-2 E404q Mutant Length = 421 Back     alignment and structure
>pdb|1CK7|A Chain A, Gelatinase A (Full-Length) Length = 631 Back     alignment and structure
>pdb|1CK7|A Chain A, Gelatinase A (Full-Length) Length = 631 Back     alignment and structure
>pdb|1QIB|A Chain A, Crystal Structure Of Gelatinase A Catalytic Domain Length = 161 Back     alignment and structure
>pdb|1JIZ|A Chain A, Crystal Structure Analysis Of Human Macrophage Elastase Mmp- 12 Length = 166 Back     alignment and structure
>pdb|1GKC|A Chain A, Mmp9-inhibitor Complex Length = 163 Back     alignment and structure
>pdb|2K2G|A Chain A, Solution Structure Of The Wild-Type Catalytic Domain Of Human Matrix Metalloproteinase 12 (Mmp-12) In Complex With A Tight-Binding Inhibitor Length = 165 Back     alignment and structure
>pdb|2Z2D|A Chain A, Solution Structure Of Human Macrophage Elastase (Mmp-12) Catalytic Domain Complexed With A Gamma-Keto Butanoic Acid Inhibitor Length = 164 Back     alignment and structure
>pdb|1GKD|A Chain A, Mmp9 Active Site Mutant-Inhibitor Complex Length = 163 Back     alignment and structure
>pdb|2OVX|A Chain A, Mmp-9 Active Site Mutant With Barbiturate Inhibitor Length = 159 Back     alignment and structure
>pdb|2POJ|A Chain A, Nmr Solution Structure Of The Inhibitor-Free State Of Macrophage Metalloelastase (Mmp-12) Length = 164 Back     alignment and structure
>pdb|3BA0|A Chain A, Crystal Structure Of Full-Length Human Mmp-12 Length = 365 Back     alignment and structure
>pdb|1OS2|A Chain A, Ternary Enzyme-Product-Inhibitor Complexes Of Human Mmp12 Length = 165 Back     alignment and structure
>pdb|3F15|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 Complexed With The Inhibitor (S)-N-(2,3-Dihydroxypropyl)-4- Methoxy-N-(2-Nitroso-2-Oxoethyl)benzenesulfonamide Length = 158 Back     alignment and structure
>pdb|1RMZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 Complexed With The Inhibitor Nngh At 1.3 A Resolution Length = 159 Back     alignment and structure
>pdb|1ROS|A Chain A, Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dioxo-1,3- Dihydro-2h-Isoindol-2-Yl)ethyl-4-(4-Ethoxy[1, 1-Biphenyl]-4- Yl)-4-Oxobutanoic Acid Length = 163 Back     alignment and structure
>pdb|2WO8|A Chain A, Mmp12 Complex With A Beta Hydroxy Carboxylic Acid Length = 164 Back     alignment and structure
>pdb|1UTT|A Chain A, Crystal Structure Of Mmp-12 Complexed To 2- (1,3-Dioxo-1,3-Dihydro-2h-Isoindol-2-Yl)ethyl-4- (4-Ethoxy[1,1-Biphenyl]-4-Yl)-4-Oxobutanoic Acid Length = 159 Back     alignment and structure
>pdb|2K9C|A Chain A, Paramagnetic Shifts In Solid-State Nmr Of Proteins To Elicit Structural Information Length = 152 Back     alignment and structure
>pdb|2W0D|A Chain A, Does A Fast Nuclear Magnetic Resonance Spectroscopy- And X-Ray Crystallography Hybrid Approach Provide Reliable Structural Information Of Ligand-Protein Complexes? A Case Study Of Metalloproteinases. Length = 164 Back     alignment and structure
>pdb|1JK3|A Chain A, Crystal Structure Of Human Mmp-12 (Macrophage Elastase) At True Atomic Resolution Length = 158 Back     alignment and structure
>pdb|4GR8|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 In Complex With Selective Phosphinic Inhibitor Rxp470c Length = 152 Back     alignment and structure
>pdb|1RM8|A Chain A, Crystal Structure Of The Catalytic Domain Of Mmp-16MT3- Mmp: Characterization Of Mt-Mmp Specific Features Length = 169 Back     alignment and structure
>pdb|3MA2|D Chain D, Complex Membrane Type-1 Matrix Metalloproteinase (Mt1-Mmp) With Tissue Inhibitor Of Metalloproteinase-1 (Timp-1) Length = 181 Back     alignment and structure
>pdb|1BQQ|M Chain M, Crystal Structure Of The Mt1-Mmp--Timp-2 Complex Length = 174 Back     alignment and structure
>pdb|1L6J|A Chain A, Crystal Structure Of Human Matrix Metalloproteinase Mmp9 (gelatinase B) Length = 425 Back     alignment and structure
>pdb|1L6J|A Chain A, Crystal Structure Of Human Matrix Metalloproteinase Mmp9 (gelatinase B) Length = 425 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 1e-64
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 4e-59
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 4e-53
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 6e-51
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 2e-50
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 1e-49
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 4e-49
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 6e-49
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 3e-47
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 4e-47
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 2e-45
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 2e-44
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 2e-44
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 4e-44
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 7e-44
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 4e-38
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 4e-36
1l6j_A425 Matrix metalloproteinase-9; twisted beta sheet fla 8e-28
1eak_A421 72 kDa type IV collagenase; hydrolase-hydrolase in 2e-33
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 2e-30
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 8e-31
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 3e-22
1k7i_A 479 PROC, secreted protease C; metalloprotease, hydrol 2e-09
1sat_A 471 Serratia protease; parallel beta helix, parallel b 2e-08
1kap_P 479 Alkaline protease; calcium binding protein, zinc m 6e-08
1g9k_A 463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pse 8e-07
1lbu_A213 Muramoyl-pentapeptide carboxypeptidase; hydrolase, 6e-04
3lmc_A210 Peptidase, zinc-dependent; structural genomics, PS 8e-04
3p24_A397 BFT-3; metzincins, metalloendopeptidase, hydrolase 8e-04
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Length = 255 Back     alignment and structure
 Score =  203 bits (516), Expect = 1e-64
 Identities = 90/277 (32%), Positives = 123/277 (44%), Gaps = 43/277 (15%)

Query: 2   DGLAKLKKYFHYFGYIP-DLPSNFTDDFDDMLESAVKTYQKNFNLEPTGQLDSQTMQHIL 60
             +  ++KY   +  +  D+           +   ++  QK   LE TG+LDS T++ + 
Sbjct: 12  TSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMR 71

Query: 61  RPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDLTYAF 120
           +PRCG PD                            VGH+  FPG+P+W           
Sbjct: 72  KPRCGVPD----------------------------VGHFRTFPGIPKWRKTHLTYRIVN 103

Query: 121 LPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFDGPMG 180
              +   D V +    A   W E T LTF+R      ADI I F   +HGD  PFDGP  
Sbjct: 104 YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLY-EGEADIMISFAVREHGDFYPFDGPGN 162

Query: 181 TLAHAFSPPN---GRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSSV 237
            LAHA++P     G  H D DE W        +   +  +L  VA HEIGH LGL HS+ 
Sbjct: 163 VLAHAYAPGPGINGDAHFDDDEQW--------TKDTTGTNLFLVAAHEIGHSLGLFHSAN 214

Query: 238 EDAIMYPSISS--GSRKVELANDDIQGIQALYGNNPN 272
            +A+MYP   S     +  L+ DDI GIQ+LYG  P+
Sbjct: 215 TEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPD 251
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Length = 450 Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Length = 167 Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Length = 168 Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Length = 168 Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Length = 174 Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Length = 167 Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Length = 173 Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Length = 163 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Length = 159 Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Length = 169 Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} PDB: 1bqq_M 1buv_M Length = 181 Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Length = 165 Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Length = 159 Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Length = 365 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Length = 479 Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A Length = 471 Back     alignment and structure
>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Length = 479 Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Length = 463 Back     alignment and structure
>1lbu_A Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus} SCOP: a.20.1.1 d.65.1.1 Length = 213 Back     alignment and structure
>3lmc_A Peptidase, zinc-dependent; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, MUR16; 2.00A {Methanocorpusculum labreanum} Length = 210 Back     alignment and structure
>3p24_A BFT-3; metzincins, metalloendopeptidase, hydrolase; HET: PG4; 1.80A {Bacteroides fragilis} Length = 397 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
1eak_A421 72 kDa type IV collagenase; hydrolase-hydrolase in 100.0
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 100.0
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 100.0
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 100.0
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 100.0
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 100.0
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 100.0
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 100.0
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 100.0
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 100.0
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 100.0
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 100.0
1k7i_A 479 PROC, secreted protease C; metalloprotease, hydrol 100.0
1kap_P 479 Alkaline protease; calcium binding protein, zinc m 100.0
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 100.0
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 100.0
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 100.0
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 100.0
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 100.0
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 100.0
1sat_A 471 Serratia protease; parallel beta helix, parallel b 100.0
1g9k_A 463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pse 100.0
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 100.0
1c7k_A132 NCNP, zinc endoprotease; alpha and beta protein, m 99.9
3edh_A201 Bone morphogenetic protein 1; vicinal disulfide, a 99.64
3lq0_A235 Proastacin; metallopeptidase, zymogen activation, 99.56
3lqb_A199 Hatching enzyme, LOC792177 protein; hydrolase, met 99.49
4gwm_A 592 Meprin A subunit beta; mulidomain structure, hydro 99.15
3p24_A397 BFT-3; metzincins, metalloendopeptidase, hydrolase 99.09
1lbu_A213 Muramoyl-pentapeptide carboxypeptidase; hydrolase, 97.95
3bkh_A268 Phikz144, lytic transglycosylase; bacteriophage, e 97.73
3d2y_A261 N-acetylmuramoyl-L-alanine amidase AMID; zinc amid 97.59
4fet_B222 Spore cortex-lytic enzyme prepeptide; transglycosy 97.53
4axq_A163 Archaemetzincin; metalloprotease, protease, hydrol 97.4
3lmc_A210 Peptidase, zinc-dependent; structural genomics, PS 97.35
2x7m_A195 Archaemetzincin; metalloprotease, protease, hydrol 97.32
2cki_A262 Ulilysin; metalloprotease, hydrolase; HET: ARG; 1. 97.19
3b8z_A217 Protein adamts-5; alpha/beta, hydrolase; HET: 294; 97.03
1qua_A197 Acutolysin-C, hemorrhagin III; metalloprotease, he 96.96
1yp1_A202 FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} 96.93
1kuf_A203 Atrolysin E, metalloproteinase; alpha/beta protein 96.87
1bud_A197 Protein (acutolysin A); metalloproteinase, snake v 96.78
2w15_A202 Zinc metalloproteinase BAP1; hydrolase inhibitor c 96.73
1r55_A214 ADAM 33; metalloprotease, inhibitor, asthma, hydro 96.61
2dw0_A 419 Catrocollastatin; apoptotic toxin, SVMP, metallopr 96.54
2v4b_A300 Adamts-1; zymogen, protease, hydrolase, metallopro 96.54
2e3x_A 427 Coagulation factor X-activating enzyme light CHAI; 96.52
2rjq_A 378 Adamts-5; metalloprotease domain, aggrecanase, cle 96.5
2rjp_A316 Adamts-4; metalloprotease domain, aggrecanase, cle 96.48
1atl_A202 Atrolysin C; metalloendopeptidase, hydrolase-hydro 96.42
2ero_A 427 VAP-1, vascular apoptosis-inducing protein 1; meta 96.39
2ddf_A257 ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapi 96.34
2i47_A288 ADAM 17; TACE-inhibitor complex, hydrolase; HET: I 96.07
4dd8_A208 Disintegrin and metalloproteinase domain-containi 95.89
3k7n_A 397 K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A { 95.68
3k7l_A 422 Atragin; SVMP, metalloprotease, hydrolase; HET: NA 95.38
1lml_A 478 Leishmanolysin; metalloprotease, glycoprotein; 1.8 94.64
3g5c_A 510 ADAM 22; alpha/beta fold, cross-linked domain, cel 92.86
3p1v_A407 Metallo-endopeptidase; structural genomics, joint 90.83
3ujz_A 869 Metalloprotease STCE; mucin-type glycoprotein, hyd 90.43
2ikb_A167 Hypothetical protein NMB1012; structural genomics, 84.19
3e11_A114 Predicted zincin-like metalloprotease; DUF1025 fam 81.59
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Back     alignment and structure
Probab=100.00  E-value=2.5e-65  Score=493.39  Aligned_cols=234  Identities=39%  Similarity=0.706  Sum_probs=204.4

Q ss_pred             CChHHHHHHHHh-cCCCCCCCCCCCCcchHHHHHHHHHHHHhcCCCCCCCCCHHHHHHhcCCCCCCCCCCCCccccCCCC
Q 021444            2 DGLAKLKKYFHY-FGYIPDLPSNFTDDFDDMLESAVKTYQKNFNLEPTGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGK   80 (312)
Q Consensus         2 ~~~~~~~~yL~~-fGYl~~~~~~~~~~~~~~~~~Ai~~fQ~~~gLpvTG~lD~~T~~~M~~pRCG~pD~~~~~~~~~~~~   80 (312)
                      +++..+++||++ ||||++..      +++++++||++||+|+||||||+||++|+++|++|||||||+           
T Consensus        14 ~~~~~a~~yL~~~yGyl~~~~------~~~~~~~Ai~~~Q~f~gL~vTG~LD~~T~~~M~~PRCGvpD~-----------   76 (421)
T 1eak_A           14 TDKELAVQYLNTFYGCPKESC------NLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV-----------   76 (421)
T ss_dssp             CHHHHHHHHHHHHTCCCSSCC------CHHHHHHHHHHHHHHSSCCCCCSCCHHHHHHHTSCBCSSCSS-----------
T ss_pred             ccHHHHHHHHHHhcCCCCCCC------chHHHHHHHHHHHHHcCCCCCCccCHHHHHHhcCCCCCCCCc-----------
Confidence            467788999999 99998642      578999999999999999999999999999999999999997           


Q ss_pred             CCCCCCCCCCCCCcccccccccCCCCCCCCCCCCceEEeecCCC-CCh-HHHHHHHHHHHHHHhhcccceEEEcccCCcc
Q 021444           81 PTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDLTYAFLPDN-QLT-DEVKNVFATAFDRWSEATSLTFTRTDVYTTA  158 (312)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~kW~~~~~~LtY~i~~~~-~~~-~~~~~~i~~A~~~Ws~~s~l~F~ev~~~~~a  158 (312)
                                       .+|+++++++||  .|++|||+|.+++ .++ ++++++|++||++|++|++|+|+||.+ ..|
T Consensus        77 -----------------~~~~~~~~~~kW--~k~~LTY~i~~~~~~l~~~~v~~~i~~AF~~Ws~vtpLtF~ev~~-~~A  136 (421)
T 1eak_A           77 -----------------ANYNFFPRKPKW--DKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHD-GEA  136 (421)
T ss_dssp             -----------------CSSCCSSCCCCC--SSSEEEEEECCCCTTSCHHHHHHHHHHHHHHHHTSSSCEEEECCS-SCC
T ss_pred             -----------------cccccccCCccc--ccceEEEEEecCCCCCCHHHHHHHHHHHHHHHhcccCceeEEcCC-CCC
Confidence                             234456678899  7999999999764 344 899999999999999999999999986 499


Q ss_pred             cEEEEeeecCCCCCCCcCCCCCcceeeeCCC---CCceEecCCCCceecCCC----------------------------
Q 021444          159 DIRIGFFTGDHGDGEPFDGPMGTLAHAFSPP---NGRFHLDGDENWVITSGT----------------------------  207 (312)
Q Consensus       159 DI~I~f~~~~hgd~~~fdG~gg~lAhA~~P~---~G~ihfd~~e~wt~~~~~----------------------------  207 (312)
                      ||+|.|.+++|||++||||+||+|||||+|+   .|+||||++|.|+++...                            
T Consensus       137 DI~I~F~~g~HgD~~pFDG~gg~LAHAf~P~~g~~Gd~HFD~dE~Wt~~~~~~~~~~~g~~~~~~C~fPF~~~g~~~~~C  216 (421)
T 1eak_A          137 DIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSC  216 (421)
T ss_dssp             SEEEEEECSSCSSSCCCCSSSSBCEEECCSSSTTTTCEEEETTSCEESSSSCCCBCBSGGGTTSBCCSSEEETTEEESSC
T ss_pred             CEEEEEecCCCCCccccCCCCCccccccCCCCCCCCceeeeeccceeccCCcceeeecccCCCCcccCCeEECCceeccc
Confidence            9999999999999999999999999999997   699999999999986420                            


Q ss_pred             ---c----------------------------------------------------------------------------
Q 021444          208 ---T----------------------------------------------------------------------------  208 (312)
Q Consensus       208 ---~----------------------------------------------------------------------------  208 (312)
                         .                                                                            
T Consensus       217 t~~g~~~g~~WCstt~~yd~d~~~~~C~~~~~~~~~gn~~~~~C~FPF~~~~~~y~~Ct~~g~~dg~~WC~tt~~yd~d~  296 (421)
T 1eak_A          217 TDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDK  296 (421)
T ss_dssp             BCTTCSSCCCEEESSSBTTTSCCEEECCCTTTCCCSTTTTTCCCCSSEEETTEEESSCBCTTCSSCCCEEESSSCTTTSC
T ss_pred             cccCccCCCceeccccccCcCCceeecCCcceeecccCCCCCcccCceeeCCeeeccccccCcccCceeeecccccCccc
Confidence               0                                                                            


Q ss_pred             ------------c-cc-----------------------------------------------CCccccchhhhhhhhhh
Q 021444          209 ------------T-SI-----------------------------------------------SMSAIDLESVAVHEIGH  228 (312)
Q Consensus       209 ------------~-~~-----------------------------------------------~~~~~~l~~Va~HEiGH  228 (312)
                                  . ..                                               ...+.+++.||+|||||
T Consensus       297 ~~~~C~~~~~~~~~gn~~G~pC~fPF~~~~~~y~~Ct~~Gr~~g~~WCatt~~fD~DekWg~Cp~~g~~l~~va~HE~GH  376 (421)
T 1eak_A          297 KYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHQFGH  376 (421)
T ss_dssp             CEEECCCCCCSCBSTTTTTCCCCSSEEETTEEESSCBCTTCSSSCCEEESSSCHHHHCCEEECCCCCEEHHHHHHHHHHH
T ss_pred             cccccCcccceeeccCCCCCceeeeEEEcceEEEeccccCCcCCceeeeeccccccccceEeeccccccchhhhhhhhhh
Confidence                        0 00                                               01346889999999999


Q ss_pred             hcCCCCCCCCCCccccccCCCCCcCCCCHHHHHHHHHHhCCCCCC
Q 021444          229 LLGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALYGNNPNF  273 (312)
Q Consensus       229 aLGL~Hs~~~~sIM~p~y~~~~~~~~L~~dDi~~Iq~LYG~~~~~  273 (312)
                      +|||.|+.+++|||+|+|+. ...+.|+.+||++||+|||.+..+
T Consensus       377 aLGL~Hs~~~~avM~p~Y~~-~~~~~l~~dDi~gIq~LYG~~~~~  420 (421)
T 1eak_A          377 AMGLEHSQDPGALMAPIYTY-TKNFRLSQDDIKGIQELYGASPDI  420 (421)
T ss_dssp             HTTCCCCSCTTSTTCSBCCC-CSSCCCCHHHHHHHHHHHCCCCCC
T ss_pred             ccCCCCCCCCCCcccccccc-CCCCCCCHHHHHHHHHHhCCCCCC
Confidence            99999999999999999985 367889999999999999987654
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} SCOP: d.92.1.11 PDB: 1bqq_M 1buv_M Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Back     alignment and structure
>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1c7k_A NCNP, zinc endoprotease; alpha and beta protein, metalloproteinase, hydrolase; 1.00A {Streptomyces caespitosus} SCOP: d.92.1.1 PDB: 1kuh_A Back     alignment and structure
>3edh_A Bone morphogenetic protein 1; vicinal disulfide, alternative splicing, calcium, chondrogenesis, cleavage on PAIR of basic residues, cytokine; 1.25A {Homo sapiens} SCOP: d.92.1.0 PDB: 3edg_A 3edi_A Back     alignment and structure
>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, D bond, hydrolase, metal-binding, metalloprotease, zymogen; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A Back     alignment and structure
>3lqb_A Hatching enzyme, LOC792177 protein; hydrolase, metalloprotease, astacin, metal- protease; 1.10A {Danio rerio} Back     alignment and structure
>4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* Back     alignment and structure
>3p24_A BFT-3; metzincins, metalloendopeptidase, hydrolase; HET: PG4; 1.80A {Bacteroides fragilis} Back     alignment and structure
>1lbu_A Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus} SCOP: a.20.1.1 d.65.1.1 Back     alignment and structure
>3bkh_A Phikz144, lytic transglycosylase; bacteriophage, endolysin, peptidoglycan, cell WALL degradation, lysozyme, hydrolase; 2.50A {Pseudomonas phage phikz} PDB: 3bkv_A* Back     alignment and structure
>3d2y_A N-acetylmuramoyl-L-alanine amidase AMID; zinc amidase, PGRP, peptidoglycan recognizing protein, AMPD, acetylmuramyl-L-alanine amidase; HET: AH0; 1.75A {Escherichia coli} PDB: 2bh7_A 2wkx_A 2bgx_A* 3d2z_A Back     alignment and structure
>4fet_B Spore cortex-lytic enzyme prepeptide; transglycosylase, cortex hydrolase domain, sodium ION, seMet hydrolase; 1.91A {Bacillus anthracis} Back     alignment and structure
>4axq_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.40A {Archaeoglobus fulgidus} PDB: 2xhq_A 3zvs_A 4a3w_A* Back     alignment and structure
>3lmc_A Peptidase, zinc-dependent; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, MUR16; 2.00A {Methanocorpusculum labreanum} Back     alignment and structure
>2x7m_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.50A {Methanopyrus kandleri} Back     alignment and structure
>2cki_A Ulilysin; metalloprotease, hydrolase; HET: ARG; 1.7A {Methanosarcina acetivorans} PDB: 2j83_A* 3lum_A* 3lun_A* Back     alignment and structure
>3b8z_A Protein adamts-5; alpha/beta, hydrolase; HET: 294; 1.40A {Homo sapiens} PDB: 3hyg_A* 3hy9_A* 3hy7_A* 3ljt_A* Back     alignment and structure
>1qua_A Acutolysin-C, hemorrhagin III; metalloprotease, hemorrhagic toxin, snake venom proteinase; 2.20A {Deinagkistrodon acutus} SCOP: d.92.1.9 Back     alignment and structure
>1yp1_A FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} Back     alignment and structure
>1kuf_A Atrolysin E, metalloproteinase; alpha/beta protein, hydrolase; 1.35A {Protobothrops mucrosquamatus} SCOP: d.92.1.9 PDB: 1kui_A 1kuk_A 1kug_A 1wni_A Back     alignment and structure
>1bud_A Protein (acutolysin A); metalloproteinase, snake venom, MMP, toxin; 1.90A {Deinagkistrodon acutus} SCOP: d.92.1.9 PDB: 1bsw_A Back     alignment and structure
>2w15_A Zinc metalloproteinase BAP1; hydrolase inhibitor complex, metal-binding, zinc-depending, metalloprotease, metalloproteinase/inhibitor complex; HET: WR2; 1.05A {Bothrops asper} PDB: 2w12_A* 2w13_A* 2w14_A* 1nd1_A 3gbo_A Back     alignment and structure
>1r55_A ADAM 33; metalloprotease, inhibitor, asthma, hydrolase; HET: NAG MAN 097; 1.58A {Homo sapiens} SCOP: d.92.1.9 PDB: 1r54_A* Back     alignment and structure
>2dw0_A Catrocollastatin; apoptotic toxin, SVMP, metalloproteinase, apoptosis, toxin; HET: NAG BMA MAN GM6; 2.15A {Crotalus atrox} PDB: 2dw1_A* 2dw2_A* 3dsl_A* 3hdb_A* Back     alignment and structure
>2v4b_A Adamts-1; zymogen, protease, hydrolase, metalloprotease, heparin-binding, metalloproteinase, metzincin, glycoprotein metal-binding; 2.00A {Homo sapiens} PDB: 2jih_A 3q2g_A* 3q2h_A* Back     alignment and structure
>2e3x_A Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Back     alignment and structure
>2rjq_A Adamts-5; metalloprotease domain, aggrecanase, cleavage on PAIR of BAS residues, extracellular matrix, glycoprotein, hydrolase, ME binding; HET: NAG BAT; 2.60A {Homo sapiens} Back     alignment and structure
>2rjp_A Adamts-4; metalloprotease domain, aggrecanase, cleavage on PAIR of basic residues, extracellular matrix, glycoprotein, hydrolase, metal-binding; HET: 886; 2.80A {Homo sapiens} PDB: 3b2z_A Back     alignment and structure
>1atl_A Atrolysin C; metalloendopeptidase, hydrolase-hydrolase inhibitor complex; HET: 0QI; 1.80A {Crotalus atrox} SCOP: d.92.1.9 PDB: 1htd_A 1dth_A* 3aig_A* 2aig_P* 4aig_A* 1iag_A Back     alignment and structure
>2ero_A VAP-1, vascular apoptosis-inducing protein 1; metalloprotease, disintegrin, calcium-binding, ADAM, SVMP, M protein, toxin; HET: NAG; 2.50A {Crotalus atrox} PDB: 2erp_A* 2erq_A* Back     alignment and structure
>2ddf_A ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapiens} PDB: 2fv5_A* 3l0v_A* 3kme_A* 3l0t_A* 3kmc_A* 3le9_A* 3lea_A* 3lgp_A* 3o64_A* 3ewj_A* 3edz_A* 3e8r_A* 2fv9_A* 1zxc_A* 2oi0_A* 3b92_A* 2a8h_A* 1bkc_A* 3cki_A 1bkc_I* ... Back     alignment and structure
>2i47_A ADAM 17; TACE-inhibitor complex, hydrolase; HET: INN KGY; 1.90A {Homo sapiens} SCOP: d.92.1.10 PDB: 3g42_A* Back     alignment and structure
>4dd8_A Disintegrin and metalloproteinase domain-containi 8; batimastat, inflammation, alpha/beta motif, metalloproteinas allergic asthma, tumorigenesis; HET: BAT; 2.10A {Homo sapiens} Back     alignment and structure
>3k7n_A K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A {Naja atra} Back     alignment and structure
>3k7l_A Atragin; SVMP, metalloprotease, hydrolase; HET: NAG; 2.50A {Naja atra} Back     alignment and structure
>1lml_A Leishmanolysin; metalloprotease, glycoprotein; 1.86A {Leishmania major} SCOP: d.92.1.3 Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Back     alignment and structure
>3p1v_A Metallo-endopeptidase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.93A {Bacteroides ovatus atcc 8483} PDB: 4df9_A* Back     alignment and structure
>3ujz_A Metalloprotease STCE; mucin-type glycoprotein, hydrolase; 2.50A {Escherichia coli} Back     alignment and structure
>2ikb_A Hypothetical protein NMB1012; structural genomics, PSI-2, MCSG, PR structure initiative; 1.70A {Neisseria meningitidis} SCOP: d.2.1.9 PDB: 2is5_A* Back     alignment and structure
>3e11_A Predicted zincin-like metalloprotease; DUF1025 family protein, zincin-like fold, conserved matrix metalloprotease motif; 1.80A {Acidothermus cellulolyticus 11B} SCOP: d.92.1.17 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 312
d1mmqa_166 d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sap 4e-45
d1hy7a_168 d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo 8e-44
d1xuca1169 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Huma 9e-43
d1i76a_163 d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Hum 2e-41
d1hv5a_162 d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus 3e-40
d2ovxa1159 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human 1e-39
d1qiba_161 d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) 4e-39
d1hfca_157 d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Hum 7e-39
d1y93a1158 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) 5e-38
d1rm8a_169 d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16 8e-36
d1bqqm_174 d.92.1.11 (M:) Membrane-type matrix metalloprotein 2e-34
d1kapp2246 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas ae 4e-27
d1k7ia2241 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrys 2e-23
d1sata2243 d.92.1.6 (A:4-246) Metalloprotease {Serratia marce 1e-20
d1slma165 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (H 1e-19
d1su3a167 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) 1e-19
d1l6ja177 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (H 9e-18
d1eaka176 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (H 9e-17
d1g9ka2242 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp 1e-16
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Matrix metalloproteases, catalytic domain
domain: Matrilysin (MMP-7)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  149 bits (376), Expect = 4e-45
 Identities = 69/175 (39%), Positives = 92/175 (52%), Gaps = 16/175 (9%)

Query: 100 YSFFPGMPRWPSNKRDLTYAFLPDNQ--LTDEVKNVFATAFDRWSEATSLTFTRTDVYTT 157
           YS FP  P+W    + +TY  +   +      V  + + A + W +   L F +   + T
Sbjct: 1   YSLFPNSPKWT--SKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVV-WGT 57

Query: 158 ADIRIGFFTGDHGDGEPFDGPMGTLAHAFSPPNGRF---HLDGDENWVITSGTTTSISMS 214
           ADI IGF  G HGD  PFDGP  TLAHAF+P  G     H D DE W   S         
Sbjct: 58  ADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGI----- 112

Query: 215 AIDLESVAVHEIGHLLGLGHSSVEDAIMYPSISSGS-RKVELANDDIQGIQALYG 268
             +    A HE+GH LG+GHSS  +A+MYP+  +G  +  +L+ DDI+GIQ LYG
Sbjct: 113 --NFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYG 165
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Length = 162 Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Length = 158 Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Length = 246 Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Length = 241 Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Length = 243 Back     information, alignment and structure
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
d1mmqa_166 Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9 100.0
d1hv5a_162 Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxI 100.0
d1xuca1169 Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxI 100.0
d1hy7a_168 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 100.0
d1i76a_163 Neutrophil collagenase (MMP-8) {Human (Homo sapien 100.0
d1hfca_157 Fibroblast collagenase (MMP-1) {Human (Homo sapien 100.0
d1qiba_161 Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2ovxa1159 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 99.97
d1kapp2246 Metalloprotease {Pseudomonas aeruginosa [TaxId: 28 99.97
d1y93a1158 Macrophage elastase (MMP-12) {Human (Homo sapiens) 99.97
d1k7ia2241 Metalloprotease {Erwinia chrysanthemi [TaxId: 556] 99.97
d1rm8a_169 Matrix metalloproteinase-16 (MMP-16) {Human (Homo 99.97
d1sata2243 Metalloprotease {Serratia marcescens [TaxId: 615]} 99.97
d1bqqm_174 Membrane-type matrix metalloproteinase (CDMT1-MMP) 99.97
d1g9ka2242 Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId 99.94
d1su3a167 Fibroblast collagenase (MMP-1) {Human (Homo sapien 99.93
d1slma165 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 99.93
d1l6ja177 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 99.91
d1eaka176 Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 99.9
d1asta_200 Astacin {European fresh water crayfish (Astacus as 99.5
d1c7ka_132 Zinc protease {Streptomyces caespitosus [TaxId: 53 98.89
d1lbua183 Zn2+ DD-carboxypeptidase, N-terminal domain {Strep 98.52
d1bswa_197 Snake venom metalloprotease {Five-pace snake (Agki 97.14
d1kufa_201 Snake venom metalloprotease {Taiwan habu (Trimeres 97.03
d2i47a1254 TNF-alpha converting enzyme, TACE, catalytic domai 96.97
d1nd1a_202 Snake venom metalloprotease {Terciopelo (Bothrops 96.93
d2bgxa181 Probable N-acetylmuramoyl-L-alanine amidase YbjR, 96.89
d1quaa_197 Snake venom metalloprotease {Chinese five-pace sna 96.88
d1atla_200 Snake venom metalloprotease {Western diamonback ra 96.67
d1r55a_203 ADAM33 {Human (Homo sapiens) [TaxId: 9606]} 96.63
d1lmla_ 475 Leishmanolysin {Leishmania major [TaxId: 5664]} 93.51
d3e11a1113 Uncharacterized protein Acel_2062 {Acidothermus ce 84.72
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Matrix metalloproteases, catalytic domain
domain: Matrilysin (MMP-7)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.9e-36  Score=257.02  Aligned_cols=160  Identities=44%  Similarity=0.795  Sum_probs=138.0

Q ss_pred             cccCCCCCCCCCCCCceEEeecCCC--CChHHHHHHHHHHHHHHhhcccceEEEcccCCcccEEEEeeecCCCCCCCcCC
Q 021444          100 YSFFPGMPRWPSNKRDLTYAFLPDN--QLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFDG  177 (312)
Q Consensus       100 ~~~~~~~~kW~~~~~~LtY~i~~~~--~~~~~~~~~i~~A~~~Ws~~s~l~F~ev~~~~~aDI~I~f~~~~hgd~~~fdG  177 (312)
                      |+++++.+||  .+++|||+|.+.+  ....+++++|++||+.|+++++++|+|+.+ ..+||+|.|....+....+++|
T Consensus         1 y~~~~~~~kW--~~~~iTY~i~~~~~~~~~~~~~~~i~~A~~~W~~v~~i~F~~v~~-~~~di~i~~~~~~~~~~~~~~~   77 (166)
T d1mmqa_           1 YSLFPNSPKW--TSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVW-GTADIMIGFARGAHGDSYPFDG   77 (166)
T ss_dssp             CCBCTTCCCC--CSSEEEEEECCCCTTSCHHHHHHHHHHHHHHHHHHSSCEEEECSS-SCCSEEEEEECSCCSSSCCCCS
T ss_pred             CCCCCCCCCC--CCCceEEEEecCCCCCCHHHHHHHHHHHHHHHhCcCCeeEEeccc-CCcceEEEEeccccCCcccccc
Confidence            5788899999  6899999998643  234789999999999999999999999986 6899999999888888888899


Q ss_pred             CCCcceeeeCCC---CCceEecCCCCceecCCCccccCCccccchhhhhhhhhhhcCCCCCCCCCCccccccCCC-CCcC
Q 021444          178 PMGTLAHAFSPP---NGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSSVEDAIMYPSISSG-SRKV  253 (312)
Q Consensus       178 ~gg~lAhA~~P~---~G~ihfd~~e~wt~~~~~~~~~~~~~~~l~~Va~HEiGHaLGL~Hs~~~~sIM~p~y~~~-~~~~  253 (312)
                      ..+.+++++.+.   .++++||..+.|....       ....+++.|++|||||||||+|++++++||||.|.+. ....
T Consensus        78 ~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~-------~~~~~~~~v~~HEiGHaLGL~H~~~~~svM~~~~~~~~~~~~  150 (166)
T d1mmqa_          78 PGNTLAHAFAPGTGLGGDAHFDEDERWTDGS-------SLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNF  150 (166)
T ss_dssp             SSSCCEEECCSSSTTTTCEEEETTSCEESSS-------SSSEEHHHHHHHHHHHHHTBCCCSCTTSTTSSSSCSSCTTSC
T ss_pred             cceeeeeccCCCccccceEEecchhhhhccc-------cccchhhhhhhhhhccccCCCCCCCCCCeECceecCCCCcCC
Confidence            999999998765   3789999888776642       3456788999999999999999999999999999764 3456


Q ss_pred             CCCHHHHHHHHHHhCC
Q 021444          254 ELANDDIQGIQALYGN  269 (312)
Q Consensus       254 ~L~~dDi~~Iq~LYG~  269 (312)
                      +|+.+||++||+|||.
T Consensus       151 ~l~~~Di~aiq~LYG~  166 (166)
T d1mmqa_         151 KLSQDDIKGIQKLYGK  166 (166)
T ss_dssp             CCCHHHHHHHHHHHCC
T ss_pred             CCCHHHHHHHHHHhCc
Confidence            8999999999999994
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Back     information, alignment and structure
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1asta_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]} Back     information, alignment and structure
>d1c7ka_ d.92.1.1 (A:) Zinc protease {Streptomyces caespitosus [TaxId: 53502]} Back     information, alignment and structure
>d1lbua1 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyces albus G [TaxId: 1962]} Back     information, alignment and structure
>d1bswa_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId: 36307]} Back     information, alignment and structure
>d1kufa_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]} Back     information, alignment and structure
>d2i47a1 d.92.1.10 (A:220-473) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd1a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]} Back     information, alignment and structure
>d2bgxa1 a.20.1.1 (A:180-260) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1quaa_ d.92.1.9 (A:) Snake venom metalloprotease {Chinese five-pace snake (Agkistrodon acutus), acutolysin C [TaxId: 36307]} Back     information, alignment and structure
>d1atla_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]} Back     information, alignment and structure
>d1r55a_ d.92.1.9 (A:) ADAM33 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmla_ d.92.1.3 (A:) Leishmanolysin {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3e11a1 d.92.1.17 (A:1-113) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure