Citrus Sinensis ID: 021524


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MDDGHHENGRYKMEYYKGTHAQWNMMPQHQMKEPNNALVMNKKIMAILAERDAAIRERNIALTEKREALETRDQALEERDKALAERDDALMARDSALAALQYREAAANFSSVGGFQRGGKRMHHPTYQSGDVPEALNSGDMHATDAKPITIIPSETKPHQAKRAKENKIVTKPSVSPRKVKKVGEDLNKKVASDGKKIKSEWDSQDGLNLVNFDETTMPVPVCTCTGTPHQCYKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEGHDLSVPLDLKNFWAKHGTNRYITIK
ccccccccccccccccccccccccccccccccccccHHHcHHHHHHHHHHcHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHcccccEEEEc
********GRYKMEYYKGTHAQWN************ALVMNKKIMAILAERDAAIRE*****************ALEERDKALAERDDALMARDSALAALQY********************************************************************************************************GLNLVNFDETTMPVPVCTCTGTPHQCYKWGNGGWQSSCCTTTLSSYPLPQ***************GSVFTKLLSRLAAEGHDLSVPLDLKNFWAKHGTNRYITIK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDGHHENGRYKMEYYKGTHAQWNMMPQHQMKEPNNALVMNKKIMAILAERDAAIRERxxxxxxxxxxxxxxxxxxxxxxxxxxxRDDALMARDSALAALQYREAAANFSSVGGFQRGGKRMHHPTYQSGDVPEALNSGDMHATDAKPITIIPSETKPHQAKRAKENKIVTKPSVSPRKVKKVGEDLNKKVASDGKKIKSEWDSQDGLNLVNFDETTMPVPVCTCTGTPHQCYKWGNGGWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEGHDLSVPLDLKNFWAKHGTNRYITIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein BASIC PENTACYSTEINE4 Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.probableQ8S8C6
Barley B recombinant-like protein D Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.probableQ5VSA8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NMD, chain A
Confidence level:probable
Coverage over the Query: 55-97
View the alignment between query and template
View the model in PyMOL
Template: 3OJA, chain B
Confidence level:probable
Coverage over the Query: 95-108
View the alignment between query and template
View the model in PyMOL