Citrus Sinensis ID: 021534


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MMGGRVIDADSKPTSPSNGERNLVLVGRTGNGKSATANSILGKKAFMSKAGSSGVTKTCEMQRTMLKAGQVVNVIDTPGLFDSSADPEFVSKEIVKCIGMAKDGIHAVLLVFSIRNRFSKEEGAAIHILESLFGKKISDYMIVVFTGGDELEDNDETLEDYLGRECPKPLKEILQLCDNRCVLFDNKTKDAAKRTEQVGKLLSLVNSVIVQNGGQPYTDEIFAELKRAELKEQMKKSYDDQLKRITEMFESKLKETTTRLEQQLAEEQAARLKAEQATQSAQTKSNDEIGKLKKDTAELREQPKNGWCAIL
ccccccccccccccccccccEEEEEEcccccccHHHHHHHHccccccccccccccccccEEEEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHHHcccccEEEEEEEEccccccHHHHHHHHHHHHHHcHHHHccEEEEEEcccccccccccHHHHHcccccHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
**********************LVLVGRTGNGKSATANSILGKKAFMSKAGSSGVTKTCEMQRTMLKAGQVVNVIDTPGLFDSSADPEFVSKEIVKCIGMAKDGIHAVLLVFSIRNRFSKEEGAAIHILESLFGKKISDYMIVVFTGGDELEDNDETLEDYLGRECPKPLKEILQLCDNRCVLFDNKTKDAAKRTEQVGKLLSLVNSVIVQNGGQPYTDEIFAEL**********************************************************************************CAIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMGGRVIDADSKPTSPSNGERNLVLVGRTGNGKSATANSILGKKAFMSKAGSSGVTKTCEMQRTMLKAGQVVNVIDTPGLFDSSADPEFVSKEIVKCIGMAKDGIHAVLLVFSIRNRFSKEEGAAIHILESLFGKKISDYMIVVFTGGDELEDNDETLEDYLGRECPKPLKEILQLCDNRCVLFDNKTKDAAKRTEQVGKLLSLVNSVIVQNGGQPYTDEIFAELKRAELKEQMKKSYDDQLKRITEMFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAQTKSNDEIGKLKKDTAELREQPKNGWCAIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GTPase IMAP family member 4 May play a role in regulating lymphocyte apoptosis (By similarity). Exhibits intrisinic GTPase activity. Shows a higher affinity for GDP over GTP (about 12-fold higher), and binding shows an absolute requirement for magnesium.probableQ9NUV9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LXX, chain A
Confidence level:very confident
Coverage over the Query: 19-151,167-217
View the alignment between query and template
View the model in PyMOL
Template: 3V70, chain A
Confidence level:confident
Coverage over the Query: 21-238
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 215-230,278-302
View the alignment between query and template
View the model in PyMOL