Citrus Sinensis ID: 021579
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 310 | ||||||
| 296089852 | 313 | unnamed protein product [Vitis vinifera] | 0.964 | 0.955 | 0.758 | 1e-135 | |
| 359487591 | 296 | PREDICTED: G patch domain-containing pro | 0.954 | 1.0 | 0.786 | 1e-135 | |
| 356572888 | 304 | PREDICTED: G patch domain-containing pro | 0.967 | 0.986 | 0.744 | 1e-128 | |
| 356505733 | 304 | PREDICTED: G patch domain-containing pro | 0.967 | 0.986 | 0.728 | 1e-127 | |
| 224124314 | 271 | predicted protein [Populus trichocarpa] | 0.874 | 1.0 | 0.819 | 1e-125 | |
| 224122816 | 295 | predicted protein [Populus trichocarpa] | 0.951 | 1.0 | 0.774 | 1e-124 | |
| 388518483 | 304 | unknown [Lotus japonicus] | 0.967 | 0.986 | 0.722 | 1e-123 | |
| 449435580 | 299 | PREDICTED: G patch domain-containing pro | 0.954 | 0.989 | 0.721 | 1e-120 | |
| 449510822 | 299 | PREDICTED: LOW QUALITY PROTEIN: G patch | 0.954 | 0.989 | 0.717 | 1e-120 | |
| 255543038 | 300 | nucleic acid binding protein, putative [ | 0.967 | 1.0 | 0.777 | 1e-119 |
| >gi|296089852|emb|CBI39671.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 486 bits (1251), Expect = e-135, Method: Compositional matrix adjust.
Identities = 245/323 (75%), Positives = 277/323 (85%), Gaps = 24/323 (7%)
Query: 1 MDYGWYNGKQGLSGRDKQPHEKEQAYQDSVIEDLAEDFRLPIHQKPIENVDLDDVEQASL 60
MD WY+G+Q S RD + E+E+AY+DS++EDLAEDFRLPI+ KP ENVDLD+VEQASL
Sbjct: 1 MDRRWYSGRQETSSRDNRQREREEAYKDSLVEDLAEDFRLPINHKPTENVDLDNVEQASL 60
Query: 61 DTKLTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDPKLGVGKQEEDDFFTAEEN 120
DT+LTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDP+LGVGKQEEDDFFTAEEN
Sbjct: 61 DTQLTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDPRLGVGKQEEDDFFTAEEN 120
Query: 121 IQRRKLDIEVEDTEENAKKRE--------------VLAEREQKIQTEVKEIRKVFYCDLC 166
IQR+KLD+E+E+TEE+AKKRE V+AEREQKIQTEVKEIRKVFYC+LC
Sbjct: 121 IQRKKLDVELEETEEHAKKREKAAYSIYVCLLTGMVVAEREQKIQTEVKEIRKVFYCELC 180
Query: 167 NKQYKLAVEFEAHLSSYDHNHRKRFKEMREMHGTSSRDDRQKREQQRQEREMAKFAQMAD 226
NKQYKLA+EFE HLSSYDHNHRKRFKEMREMHGTSSRDDRQKREQQRQEREMAKFA MAD
Sbjct: 181 NKQYKLAMEFEVHLSSYDHNHRKRFKEMREMHGTSSRDDRQKREQQRQEREMAKFALMAD 240
Query: 227 AHKQQQEQKQRQQDQQQQDEESGSVSVPTAPGTTTALANQDQRKALKFGFSSKGGTSKNT 286
A KQQQ+Q++ ESG+ +V T + T LA+Q+QRKALKFGFSSKGG SKN+
Sbjct: 241 ARKQQQQQEE----------ESGNTAVSTTLRSATPLADQEQRKALKFGFSSKGGMSKNS 290
Query: 287 TGSAAKKPKVAVASVFGHDSDEE 309
+GSAAKKPKV+VASVF +DSDEE
Sbjct: 291 SGSAAKKPKVSVASVFSNDSDEE 313
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359487591|ref|XP_003633617.1| PREDICTED: G patch domain-containing protein 8-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356572888|ref|XP_003554597.1| PREDICTED: G patch domain-containing protein 8-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356505733|ref|XP_003521644.1| PREDICTED: G patch domain-containing protein 8-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224124314|ref|XP_002329992.1| predicted protein [Populus trichocarpa] gi|222871417|gb|EEF08548.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224122816|ref|XP_002318923.1| predicted protein [Populus trichocarpa] gi|222857299|gb|EEE94846.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388518483|gb|AFK47303.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|449435580|ref|XP_004135573.1| PREDICTED: G patch domain-containing protein 8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449510822|ref|XP_004163770.1| PREDICTED: LOW QUALITY PROTEIN: G patch domain-containing protein 8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255543038|ref|XP_002512582.1| nucleic acid binding protein, putative [Ricinus communis] gi|223548543|gb|EEF50034.1| nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 310 | ||||||
| TAIR|locus:2146839 | 301 | AT5G26610 [Arabidopsis thalian | 0.967 | 0.996 | 0.596 | 1.1e-87 | |
| ZFIN|ZDB-GENE-030131-6966 | 1498 | gpatch8 "G patch domain contai | 0.512 | 0.106 | 0.422 | 1.9e-29 | |
| MGI|MGI:1918667 | 1505 | Gpatch8 "G patch domain contai | 0.454 | 0.093 | 0.445 | 8.3e-29 | |
| UNIPROTKB|F1M1F0 | 635 | LOC688211 "Protein LOC688211" | 0.454 | 0.222 | 0.445 | 2e-28 | |
| RGD|1596463 | 1494 | Gpatch8 "G patch domain contai | 0.454 | 0.094 | 0.445 | 1.1e-27 | |
| UNIPROTKB|E2RIL0 | 1502 | GPATCH8 "Uncharacterized prote | 0.454 | 0.093 | 0.445 | 1.1e-27 | |
| UNIPROTKB|J9P741 | 1502 | GPATCH8 "Uncharacterized prote | 0.454 | 0.093 | 0.445 | 1.1e-27 | |
| UNIPROTKB|Q9UKJ3 | 1502 | GPATCH8 "G patch domain-contai | 0.454 | 0.093 | 0.445 | 1.1e-27 | |
| UNIPROTKB|E1BC37 | 1509 | GPATCH8 "Uncharacterized prote | 0.454 | 0.093 | 0.445 | 1.1e-27 | |
| UNIPROTKB|K7EKU0 | 221 | GPATCH8 "G patch domain-contai | 0.409 | 0.574 | 0.439 | 2.2e-25 |
| TAIR|locus:2146839 AT5G26610 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 876 (313.4 bits), Expect = 1.1e-87, P = 1.1e-87
Identities = 185/310 (59%), Positives = 214/310 (69%)
Query: 1 MDYGWYNGKQGLSGRDKQPHEKEQAYQDSVIEDLAEDFRLPIHQKPIENVDLDDVEQASL 60
MD K S R+K+ +EK+Q Q+S IE LAE+FRLPI + ENVDL+DVEQASL
Sbjct: 1 MDISRRESKTEASSREKRIYEKDQMNQESFIEGLAEEFRLPITHRVTENVDLEDVEQASL 60
Query: 61 DTKLTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDPKLGVGKQEEDDFFTAEEN 120
D K++SSN+GFRLLQKMGWKGKGLGK EQGI EPIKSGIRD +LG+GKQEEDD+FTAEEN
Sbjct: 61 DVKISSSNVGFRLLQKMGWKGKGLGKQEQGITEPIKSGIRDRRLGLGKQEEDDYFTAEEN 120
Query: 121 IQRRKLDIEVEDTEENAKKREVLAEREQKIQTEVKEIRKVFYCDLCNKQYKLAVEFEAHL 180
IQR+KLDIE+E+TEE AKKREVLAEREQKIQ++VKEIRKVFYC+LC+KQY+ +EFE HL
Sbjct: 121 IQRKKLDIEIEETEEIAKKREVLAEREQKIQSDVKEIRKVFYCELCSKQYRTVMEFEGHL 180
Query: 181 SSYDHNHRKRFKEMREMHGTSSRDDXXXXXXXXXXXXMAKFAQMADAHXXXXXXXXXXXX 240
SSYDHNH+KRFKEM+EMHG S RD+ M K MADA
Sbjct: 181 SSYDHNHKKRFKEMKEMHGASGRDERKKREQQRQEREMTK---MADARKQHQMQQSQQEV 237
Query: 241 XXXXXXXSGSVSVPTAPGTTTALANQDQRKALKFGFSSKGGT-SKNTTGXXXXXXXXXXX 299
VS P A T LA QDQRK LKFGFSSK G SK+
Sbjct: 238 PENV-----PVSAP-AKTTVAPLAVQDQRKTLKFGFSSKSGIISKSQPTSSIKKPKVAIA 291
Query: 300 XXFGHDSDEE 309
FG+DSDE+
Sbjct: 292 SVFGNDSDED 301
|
|
| ZFIN|ZDB-GENE-030131-6966 gpatch8 "G patch domain containing 8" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1918667 Gpatch8 "G patch domain containing 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M1F0 LOC688211 "Protein LOC688211" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1596463 Gpatch8 "G patch domain containing 8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RIL0 GPATCH8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P741 GPATCH8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UKJ3 GPATCH8 "G patch domain-containing protein 8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BC37 GPATCH8 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7EKU0 GPATCH8 "G patch domain-containing protein 8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 310 | |||
| smart00443 | 47 | smart00443, G_patch, glycine rich nucleic binding | 9e-16 | |
| pfam01585 | 45 | pfam01585, G-patch, G-patch domain | 3e-15 | |
| smart00451 | 35 | smart00451, ZnF_U1, U1-like zinc finger | 2e-04 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 0.004 |
| >gnl|CDD|197727 smart00443, G_patch, glycine rich nucleic binding domain | Back alignment and domain information |
|---|
Score = 69.9 bits (172), Expect = 9e-16
Identities = 26/46 (56%), Positives = 38/46 (82%), Gaps = 1/46 (2%)
Query: 64 LTSSNIGFRLLQKMGWK-GKGLGKDEQGIIEPIKSGIRDPKLGVGK 108
+++SNIG +LL+KMGWK G+GLGK+EQGI+EPI + I+ + G+G
Sbjct: 1 ISTSNIGAKLLRKMGWKEGQGLGKNEQGIVEPISAEIKKDRKGLGA 46
|
A predicted glycine rich nucleic binding domain found in the splicing factor 45, SON DNA binding protein and D-type Retrovirus- polyproteins. Length = 47 |
| >gnl|CDD|144978 pfam01585, G-patch, G-patch domain | Back alignment and domain information |
|---|
| >gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 310 | |||
| PF01585 | 45 | G-patch: G-patch domain; InterPro: IPR000467 The D | 99.43 | |
| smart00443 | 47 | G_patch glycine rich nucleic binding domain. A pre | 99.3 | |
| KOG2809 | 326 | consensus Telomerase elongation inhibitor/RNA matu | 99.09 | |
| KOG0965 | 988 | consensus Predicted RNA-binding protein, contains | 98.82 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.7 | |
| KOG2185 | 486 | consensus Predicted RNA-processing protein, contai | 98.7 | |
| PF12656 | 77 | G-patch_2: DExH-box splicing factor binding site | 98.69 | |
| KOG1994 | 268 | consensus Predicted RNA binding protein, contains | 98.65 | |
| KOG2184 | 767 | consensus Tuftelin-interacting protein TIP39, cont | 98.55 | |
| KOG0154 | 573 | consensus RNA-binding protein RBM5 and related pro | 98.5 | |
| KOG3673 | 845 | consensus FtsJ-like RNA methyltransferase [RNA pro | 98.05 | |
| KOG4727 | 193 | consensus U1-like Zn-finger protein [General funct | 97.79 | |
| KOG4368 | 757 | consensus Predicted RNA binding protein, contains | 97.74 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 97.71 | |
| KOG1996 | 378 | consensus mRNA splicing factor [RNA processing and | 97.67 | |
| KOG4315 | 455 | consensus G-patch nucleic acid binding protein [Ge | 97.43 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 97.3 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 97.17 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 94.38 | |
| KOG2138 | 883 | consensus Predicted RNA binding protein, contains | 93.21 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 93.07 | |
| KOG3408 | 129 | consensus U1-like Zn-finger-containing protein, pr | 91.39 | |
| KOG1994 | 268 | consensus Predicted RNA binding protein, contains | 91.28 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 91.25 | |
| KOG2785 | 390 | consensus C2H2-type Zn-finger protein [General fun | 90.22 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 89.35 | |
| smart00586 | 49 | ZnF_DBF Zinc finger in DBF-like proteins. | 89.16 | |
| PF07535 | 49 | zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc | 87.76 | |
| PF15473 | 150 | PCNP: PEST, proteolytic signal-containing nuclear | 86.35 | |
| KOG0150 | 336 | consensus Spliceosomal protein FBP21 [RNA processi | 85.16 | |
| COG5188 | 470 | PRP9 Splicing factor 3a, subunit 3 [RNA processing | 84.19 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 82.84 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 82.41 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 80.68 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 80.25 | |
| PF06220 | 38 | zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi | 80.02 |
| >PF01585 G-patch: G-patch domain; InterPro: IPR000467 The D111/G-patch domain [] is a short conserved region of about 40 amino acids which occurs in a number of putative RNA-binding proteins, including tumor suppressor and DNA-damage-repair proteins, suggesting that this domain may have an RNA binding function | Back alignment and domain information |
|---|
Probab=99.43 E-value=1.4e-13 Score=97.76 Aligned_cols=44 Identities=52% Similarity=1.050 Sum_probs=42.0
Q ss_pred CCcHHHHHHHhcCCC-CCCCCCCCCCcccceeeeecCCCccccCC
Q 021579 66 SSNIGFRLLQKMGWK-GKGLGKDEQGIIEPIKSGIRDPKLGVGKQ 109 (310)
Q Consensus 66 ~sniG~kML~KMGWk-G~GLGk~~qGi~ePI~~~~k~~~~GLGa~ 109 (310)
++++|++||.+|||+ |+|||++.+||++||.+..+.++.|||+.
T Consensus 1 t~~~g~~lm~kmGw~~G~GLGk~~~G~~~pi~~~~~~~~~GlG~~ 45 (45)
T PF01585_consen 1 TSSIGFKLMKKMGWKPGQGLGKNGQGIAEPIEVKKKKDRKGLGAE 45 (45)
T ss_pred CCcHHHHHHHHCCCCCCcCCCcCCccCCcceEEeeEcCCccccCC
Confidence 479999999999999 99999999999999999999999999973
|
This domain has seven highly conserved glycines. A multiple alignment of a small subset of D111/G-patch domains is shown in Fig. 2b of [].; GO: 0003676 nucleic acid binding, 0005622 intracellular |
| >smart00443 G_patch glycine rich nucleic binding domain | Back alignment and domain information |
|---|
| >KOG2809 consensus Telomerase elongation inhibitor/RNA maturation protein PINX1 [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0965 consensus Predicted RNA-binding protein, contains SWAP and G-patch domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12656 G-patch_2: DExH-box splicing factor binding site | Back alignment and domain information |
|---|
| >KOG1994 consensus Predicted RNA binding protein, contains G-patch and Zn-finger domains [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2184 consensus Tuftelin-interacting protein TIP39, contains G-patch domain [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0154 consensus RNA-binding protein RBM5 and related proteins, contain G-patch and RRM domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3673 consensus FtsJ-like RNA methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4727 consensus U1-like Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4368 consensus Predicted RNA binding protein, contains SWAP, RPR and G-patch domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >KOG1996 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4315 consensus G-patch nucleic acid binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2138 consensus Predicted RNA binding protein, contains G-patch domain [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1994 consensus Predicted RNA binding protein, contains G-patch and Zn-finger domains [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >smart00586 ZnF_DBF Zinc finger in DBF-like proteins | Back alignment and domain information |
|---|
| >PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF15473 PCNP: PEST, proteolytic signal-containing nuclear protein family | Back alignment and domain information |
|---|
| >KOG0150 consensus Spliceosomal protein FBP21 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 310 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 45.6 bits (107), Expect = 1e-05
Identities = 31/189 (16%), Positives = 63/189 (33%), Gaps = 56/189 (29%)
Query: 16 DKQPHEKEQAYQDSVIEDLAEDFRLPIHQKPIENVDLDDVEQASLDTKLTSSNIG----- 70
D + E + Y+D ++ + F ++N D DV+ + L+ I
Sbjct: 8 DFETGEHQYQYKD-ILSVFEDAF--------VDNFDCKDVQD-MPKSILSKEEIDHIIMS 57
Query: 71 -------FRLLQKMGWKGK---------GLGKDEQGIIEPIKSGIRDPKLGVGKQEEDDF 114
RL + K + L + + ++ PIK+ R P + +
Sbjct: 58 KDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSM-----MTRMY 112
Query: 115 FTAEENIQRRKLDIEVEDTEENAKKREVLAEREQ---KIQTEVKEIRKVFYCDL-----C 166
+ + D +V K V R Q K++ + E+R +
Sbjct: 113 IEQRDRLYN---DNQV------FAKYNV--SRLQPYLKLRQALLELRPAKNVLIDGVLGS 161
Query: 167 NKQYKLAVE 175
K + +A++
Sbjct: 162 GKTW-VALD 169
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 310 | |||
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 96.11 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 95.77 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 92.39 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 91.57 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 90.12 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 90.11 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 89.08 | |
| 1fu9_A | 36 | U-shaped transcriptional cofactor; zinc-finger, be | 88.94 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 88.79 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 88.08 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 88.05 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 87.78 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 87.38 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 86.91 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 86.67 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 86.62 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 86.51 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.48 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.2 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 85.96 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 85.93 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 85.62 | |
| 3cw1_L | 77 | U1 small nuclear ribonucleoprotein C; PRE-mRNA spl | 85.44 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 84.93 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 84.82 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 84.66 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 84.37 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 84.35 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 84.25 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 84.24 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 83.7 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 83.57 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 83.3 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 83.05 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 83.03 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 83.03 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 83.02 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 82.93 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 82.86 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 82.81 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 82.5 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 82.31 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 82.03 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 81.91 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 81.84 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 81.66 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 81.55 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 81.36 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 81.35 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 81.34 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 81.21 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 81.11 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 80.89 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 80.84 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 80.79 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 80.79 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 80.73 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 80.64 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.62 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.57 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 80.54 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 80.46 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 80.42 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 80.18 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 80.11 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 80.06 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 80.04 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 80.02 |
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
Probab=96.11 E-value=0.0013 Score=55.19 Aligned_cols=37 Identities=24% Similarity=0.522 Sum_probs=31.9
Q ss_pred hhhhhhhhhhhhhhhHHHHHhhccchhhhHHHHHHHHHH
Q 021579 158 RKVFYCDLCNKQYKLAVEFEAHLSSYDHNHRKRFKEMRE 196 (310)
Q Consensus 158 rkvFyC~lCnkqy~~~~eye~Hlnsy~H~h~~Rlk~lk~ 196 (310)
.+.|||..|++.|.+...|..|++|..| ++|++.|+.
T Consensus 48 ekpfyC~~C~K~F~~~~~L~~H~rsK~H--Krrvk~l~~ 84 (124)
T 1zr9_A 48 GGLHRCLACARYFIDSTNLKTHFRSKDH--KKRLKQLSV 84 (124)
T ss_dssp GGCSEETTTTEECSSHHHHHHHTTCHHH--HHHHHHHTS
T ss_pred CcceEcccCcchhCCHHHHHHHHhhhhh--hHHHHHhcc
Confidence 4689999999999999999999998765 667777764
|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 310 | |||
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 97.42 | |
| d1zu1a2 | 55 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 93.71 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 90.19 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 89.45 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 89.3 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 88.91 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 88.68 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 84.89 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 82.71 | |
| d2vrda1 | 61 | Spliceosomal protein U1C {Human (Homo sapiens) [Ta | 82.5 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 81.85 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 81.84 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 80.65 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 80.49 |
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: HkH motif-containing C2H2 finger domain: Zinc finger protein 593, ZNF593 species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.42 E-value=1.4e-05 Score=58.98 Aligned_cols=35 Identities=26% Similarity=0.572 Sum_probs=31.6
Q ss_pred hhhhhhhhhhhhhHHHHHhhccchhhhHHHHHHHHHH
Q 021579 160 VFYCDLCNKQYKLAVEFEAHLSSYDHNHRKRFKEMRE 196 (310)
Q Consensus 160 vFyC~lCnkqy~~~~eye~Hlnsy~H~h~~Rlk~lk~ 196 (310)
-|||-.|++.|.+...|.+|++|..| ++|++.|+.
T Consensus 15 qfYCv~C~K~F~se~~l~~H~ksKkH--Krrvk~L~~ 49 (67)
T d1zr9a1 15 LHRCLACARYFIDSTNLKTHFRSKDH--KKRLKQLSV 49 (67)
T ss_dssp CSEETTTTEECSSHHHHHHHTTCHHH--HHHHHHHTS
T ss_pred EEecccccCccCCHHHHHHHHcccHH--HHHHHHhcc
Confidence 39999999999999999999999976 678998865
|
| >d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|