Citrus Sinensis ID: 021579


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MDYGWYNGKQGLSGRDKQPHEKEQAYQDSVIEDLAEDFRLPIHQKPIENVDLDDVEQASLDTKLTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDPKLGVGKQEEDDFFTAEENIQRRKLDIEVEDTEENAKKREVLAEREQKIQTEVKEIRKVFYCDLCNKQYKLAVEFEAHLSSYDHNHRKRFKEMREMHGTSSRDDRQKREQQRQEREMAKFAQMADAHKQQQEQKQRQQDQQQQDEESGSVSVPTAPGTTTALANQDQRKALKFGFSSKGGTSKNTTGSAAKKPKVAVASVFGHDSDEEQ
ccccccccccccccccccccHHHHHHHccHHHHHHHHHcccccccccccccccHHHccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHccccccccccccccHHHHHHHHcccccccccccccccEccEEEEEccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccEEEEEccccccccc
mdygwyngkqglsgrdkqphekeQAYQDSVIEDLAedfrlpihqkpienvdlddveqasldtkltssniGFRLLQKmgwkgkglgkdeqgiiepiksgirdpklgvgkqeeddfFTAEENIQRRKLDIEVEDTEENAKKREVLAEREQKIQTEVKEIRKVFYCDLCNKQYKLAVEFEAHLSSYDHNHRKRFKEMRemhgtssrddRQKREQQRQEREMAKFAQMADAHKQQQEQKQRQQDQqqqdeesgsvsvptapgtttaLANQDQRKALKfgfsskggtsknttgsaakkpKVAVASvfghdsdeeq
mdygwyngkqglsgrdkqphEKEQAYQDSVIEDLAEDFRLPIHQKPIENVDLDDVEQASLdtkltssnigfrlLQKMgwkgkglgkdeqgiiepiksgirdpklgvGKQEEddfftaeeniqrrkldievedteenakkrevlaereqkiqtevKEIRKVFYCDLCNKQYKLAVEFEAHLSSYDHNHRKRFKEMremhgtssrddrqKREQQRQEREMAKFAQMADAHKQQQEQKQRQQDQQQQDEESGSVSVPTAPGTTTALANQDQRKALKfgfsskggtsknttgsaakkpkvaVASVfghdsdeeq
MDYGWYNGKQGLSGRDKQPHEKEQAYQDSVIEDLAEDFRLPIHQKPIENVDLDDVEQASLDTKLTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDPKLGVGKQEEDDFFTAEENIQRRKLDIEVEDTEENAKKREVLAEREQKIQTEVKEIRKVFYCDLCNKQYKLAVEFEAHLSSYDHNHRKRFKEMREMHGTSSRDDrqkreqqrqereMAKFAQMADAHkqqqeqkqrqqdqqqqdeeSGSVSVPTAPGTTTALANQDQRKALKFGFSSKGGTSKNTTGsaakkpkvavasvFGHDSDEEQ
********************************DLAEDFRLPIHQKPIENVDLDDV****LDTKLTSSNIGFRLLQKMGWKGKGLGKD*QGIIE**********************************************************TEVKEIRKVFYCDLCNKQYKLAVEFEAHLSS********************************************************************************************************************************
***********************************************************************RLLQKM*******************SGI***********EDDFFTAEENIQRRKLDIEVEDTEENAKKREVLAEREQKIQTEVKEIRKVFYCDLCNKQY********************************************************************************************************************************************
MDYGWYNGKQG***************QDSVIEDLAEDFRLPIHQKPIENVDLDDVEQASLDTKLTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDPKLGVGKQEEDDFFTAEENIQRRKLDIEVEDTEENAKKREVLAEREQKIQTEVKEIRKVFYCDLCNKQYKLAVEFEAHLSSYDHNHRKRFKEM************************************************************TAPGTTTALANQDQRKALKFGFSSK*****************AVASVFGHDSDEEQ
*******************HEKEQAYQDSVIEDLAEDFRLPIHQKPIENVDLDDVEQASLDTKLTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDPKLGVGKQEEDDFFTAEENIQRRKL***VEDTEENAKKREVLAEREQKIQTEVKEIRKVFYCDLCNKQYKLAVEFEAHLSSYDHNHRKRFKEMREMH*******************MAKFAQMADAHKQQQ*************************************KAL****S******************VA*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYGWYNGKQGLSGRDKQPHEKEQAYQDSVIEDLAEDFRLPIHQKPIENVDLDDVEQASLDTKLTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDPKLGVGKQEEDDFFTAEENIQRRKLDIEVEDTEENAKKREVLAEREQKIQTEVKEIRKVFYCDLCNKQYKLAVEFEAHLSSYDHNHRKRFKEMREMHGTSSRDDRQKREQQRQEREMAKxxxxxxxxxxxxxxxxxxxxxxxxxxxxGSVSVPTAPGTTTALANQDQRKALKFGFSSKGGTSKNTTGSAAKKPKVAVASVFGHDSDEEQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query310 2.2.26 [Sep-21-2011]
A2A6A1 1505 G patch domain-containing yes no 0.577 0.118 0.372 7e-31
Q9UKJ3 1502 G patch domain-containing yes no 0.577 0.119 0.372 9e-31
A2AKY4 1200 Zinc finger protein 804A no no 0.306 0.079 0.305 2e-10
Q7Z570 1209 Zinc finger protein 804A no no 0.306 0.078 0.305 3e-10
A4D1E1 1349 Zinc finger protein 804B no no 0.254 0.058 0.303 2e-08
Q6DF57261 Coiled-coil domain-contai no no 0.274 0.325 0.451 3e-08
P98175930 RNA-binding protein 10 OS no no 0.212 0.070 0.441 3e-06
Q99KG3930 RNA-binding protein 10 OS no no 0.212 0.070 0.441 3e-06
P70501852 RNA-binding protein 10 OS no no 0.212 0.077 0.441 3e-06
Q6DGZ0262 Coiled-coil domain-contai no no 0.212 0.251 0.376 1e-05
>sp|A2A6A1|GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus GN=Gpatch8 PE=2 SV=1 Back     alignment and function desciption
 Score =  134 bits (338), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 118/180 (65%), Gaps = 1/180 (0%)

Query: 54  DVEQASLDTKLTSSNIGFRLLQKMGWK-GKGLGKDEQGIIEPIKSGIRDPKLGVGKQEED 112
           ++EQASLD  + S NIG RLLQK GWK G+GLGK  QG  +PI   ++   +G+G+ E +
Sbjct: 28  EIEQASLDKPIESDNIGHRLLQKHGWKLGQGLGKSLQGRTDPIPIVVKYDVMGMGRMEME 87

Query: 113 DFFTAEENIQRRKLDIEVEDTEENAKKREVLAEREQKIQTEVKEIRKVFYCDLCNKQYKL 172
             +  +   +RR L++E EDTEE  +K +   ++E+ I   ++++R  FYC+LC+KQY+ 
Sbjct: 88  LDYAEDATERRRVLEVEKEDTEELRQKYKDYVDKEKAIAKALEDLRANFYCELCDKQYQK 147

Query: 173 AVEFEAHLSSYDHNHRKRFKEMREMHGTSSRDDRQKREQQRQEREMAKFAQMADAHKQQQ 232
             EF+ H++SYDH H++R K++++     +   R ++++++QE+ + +  ++A+  KQ +
Sbjct: 148 HQEFDNHINSYDHAHKQRLKDLKQREFARNVSSRSRKDEKKQEKALRRLHELAEQRKQAE 207





Mus musculus (taxid: 10090)
>sp|Q9UKJ3|GPTC8_HUMAN G patch domain-containing protein 8 OS=Homo sapiens GN=GPATCH8 PE=1 SV=2 Back     alignment and function description
>sp|A2AKY4|Z804A_MOUSE Zinc finger protein 804A OS=Mus musculus GN=Znf804a PE=2 SV=1 Back     alignment and function description
>sp|Q7Z570|Z804A_HUMAN Zinc finger protein 804A OS=Homo sapiens GN=ZNF804A PE=1 SV=3 Back     alignment and function description
>sp|A4D1E1|Z804B_HUMAN Zinc finger protein 804B OS=Homo sapiens GN=ZNF804B PE=2 SV=2 Back     alignment and function description
>sp|Q6DF57|CCD75_XENTR Coiled-coil domain-containing protein 75 OS=Xenopus tropicalis GN=ccdc75 PE=2 SV=1 Back     alignment and function description
>sp|P98175|RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 Back     alignment and function description
>sp|Q99KG3|RBM10_MOUSE RNA-binding protein 10 OS=Mus musculus GN=Rbm10 PE=1 SV=1 Back     alignment and function description
>sp|P70501|RBM10_RAT RNA-binding protein 10 OS=Rattus norvegicus GN=Rbm10 PE=2 SV=1 Back     alignment and function description
>sp|Q6DGZ0|CCD75_DANRE Coiled-coil domain-containing protein 75 OS=Danio rerio GN=ccdc75 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
296089852313 unnamed protein product [Vitis vinifera] 0.964 0.955 0.758 1e-135
359487591296 PREDICTED: G patch domain-containing pro 0.954 1.0 0.786 1e-135
356572888304 PREDICTED: G patch domain-containing pro 0.967 0.986 0.744 1e-128
356505733304 PREDICTED: G patch domain-containing pro 0.967 0.986 0.728 1e-127
224124314271 predicted protein [Populus trichocarpa] 0.874 1.0 0.819 1e-125
224122816295 predicted protein [Populus trichocarpa] 0.951 1.0 0.774 1e-124
388518483304 unknown [Lotus japonicus] 0.967 0.986 0.722 1e-123
449435580299 PREDICTED: G patch domain-containing pro 0.954 0.989 0.721 1e-120
449510822299 PREDICTED: LOW QUALITY PROTEIN: G patch 0.954 0.989 0.717 1e-120
255543038300 nucleic acid binding protein, putative [ 0.967 1.0 0.777 1e-119
>gi|296089852|emb|CBI39671.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 245/323 (75%), Positives = 277/323 (85%), Gaps = 24/323 (7%)

Query: 1   MDYGWYNGKQGLSGRDKQPHEKEQAYQDSVIEDLAEDFRLPIHQKPIENVDLDDVEQASL 60
           MD  WY+G+Q  S RD +  E+E+AY+DS++EDLAEDFRLPI+ KP ENVDLD+VEQASL
Sbjct: 1   MDRRWYSGRQETSSRDNRQREREEAYKDSLVEDLAEDFRLPINHKPTENVDLDNVEQASL 60

Query: 61  DTKLTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDPKLGVGKQEEDDFFTAEEN 120
           DT+LTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDP+LGVGKQEEDDFFTAEEN
Sbjct: 61  DTQLTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDPRLGVGKQEEDDFFTAEEN 120

Query: 121 IQRRKLDIEVEDTEENAKKRE--------------VLAEREQKIQTEVKEIRKVFYCDLC 166
           IQR+KLD+E+E+TEE+AKKRE              V+AEREQKIQTEVKEIRKVFYC+LC
Sbjct: 121 IQRKKLDVELEETEEHAKKREKAAYSIYVCLLTGMVVAEREQKIQTEVKEIRKVFYCELC 180

Query: 167 NKQYKLAVEFEAHLSSYDHNHRKRFKEMREMHGTSSRDDRQKREQQRQEREMAKFAQMAD 226
           NKQYKLA+EFE HLSSYDHNHRKRFKEMREMHGTSSRDDRQKREQQRQEREMAKFA MAD
Sbjct: 181 NKQYKLAMEFEVHLSSYDHNHRKRFKEMREMHGTSSRDDRQKREQQRQEREMAKFALMAD 240

Query: 227 AHKQQQEQKQRQQDQQQQDEESGSVSVPTAPGTTTALANQDQRKALKFGFSSKGGTSKNT 286
           A KQQQ+Q++          ESG+ +V T   + T LA+Q+QRKALKFGFSSKGG SKN+
Sbjct: 241 ARKQQQQQEE----------ESGNTAVSTTLRSATPLADQEQRKALKFGFSSKGGMSKNS 290

Query: 287 TGSAAKKPKVAVASVFGHDSDEE 309
           +GSAAKKPKV+VASVF +DSDEE
Sbjct: 291 SGSAAKKPKVSVASVFSNDSDEE 313




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359487591|ref|XP_003633617.1| PREDICTED: G patch domain-containing protein 8-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356572888|ref|XP_003554597.1| PREDICTED: G patch domain-containing protein 8-like [Glycine max] Back     alignment and taxonomy information
>gi|356505733|ref|XP_003521644.1| PREDICTED: G patch domain-containing protein 8-like [Glycine max] Back     alignment and taxonomy information
>gi|224124314|ref|XP_002329992.1| predicted protein [Populus trichocarpa] gi|222871417|gb|EEF08548.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224122816|ref|XP_002318923.1| predicted protein [Populus trichocarpa] gi|222857299|gb|EEE94846.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388518483|gb|AFK47303.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449435580|ref|XP_004135573.1| PREDICTED: G patch domain-containing protein 8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449510822|ref|XP_004163770.1| PREDICTED: LOW QUALITY PROTEIN: G patch domain-containing protein 8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255543038|ref|XP_002512582.1| nucleic acid binding protein, putative [Ricinus communis] gi|223548543|gb|EEF50034.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
TAIR|locus:2146839301 AT5G26610 [Arabidopsis thalian 0.967 0.996 0.596 1.1e-87
ZFIN|ZDB-GENE-030131-6966 1498 gpatch8 "G patch domain contai 0.512 0.106 0.422 1.9e-29
MGI|MGI:1918667 1505 Gpatch8 "G patch domain contai 0.454 0.093 0.445 8.3e-29
UNIPROTKB|F1M1F0 635 LOC688211 "Protein LOC688211" 0.454 0.222 0.445 2e-28
RGD|1596463 1494 Gpatch8 "G patch domain contai 0.454 0.094 0.445 1.1e-27
UNIPROTKB|E2RIL0 1502 GPATCH8 "Uncharacterized prote 0.454 0.093 0.445 1.1e-27
UNIPROTKB|J9P741 1502 GPATCH8 "Uncharacterized prote 0.454 0.093 0.445 1.1e-27
UNIPROTKB|Q9UKJ3 1502 GPATCH8 "G patch domain-contai 0.454 0.093 0.445 1.1e-27
UNIPROTKB|E1BC37 1509 GPATCH8 "Uncharacterized prote 0.454 0.093 0.445 1.1e-27
UNIPROTKB|K7EKU0221 GPATCH8 "G patch domain-contai 0.409 0.574 0.439 2.2e-25
TAIR|locus:2146839 AT5G26610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 876 (313.4 bits), Expect = 1.1e-87, P = 1.1e-87
 Identities = 185/310 (59%), Positives = 214/310 (69%)

Query:     1 MDYGWYNGKQGLSGRDKQPHEKEQAYQDSVIEDLAEDFRLPIHQKPIENVDLDDVEQASL 60
             MD      K   S R+K+ +EK+Q  Q+S IE LAE+FRLPI  +  ENVDL+DVEQASL
Sbjct:     1 MDISRRESKTEASSREKRIYEKDQMNQESFIEGLAEEFRLPITHRVTENVDLEDVEQASL 60

Query:    61 DTKLTSSNIGFRLLQKMGWKGKGLGKDEQGIIEPIKSGIRDPKLGVGKQEEDDFFTAEEN 120
             D K++SSN+GFRLLQKMGWKGKGLGK EQGI EPIKSGIRD +LG+GKQEEDD+FTAEEN
Sbjct:    61 DVKISSSNVGFRLLQKMGWKGKGLGKQEQGITEPIKSGIRDRRLGLGKQEEDDYFTAEEN 120

Query:   121 IQRRKLDIEVEDTEENAKKREVLAEREQKIQTEVKEIRKVFYCDLCNKQYKLAVEFEAHL 180
             IQR+KLDIE+E+TEE AKKREVLAEREQKIQ++VKEIRKVFYC+LC+KQY+  +EFE HL
Sbjct:   121 IQRKKLDIEIEETEEIAKKREVLAEREQKIQSDVKEIRKVFYCELCSKQYRTVMEFEGHL 180

Query:   181 SSYDHNHRKRFKEMREMHGTSSRDDXXXXXXXXXXXXMAKFAQMADAHXXXXXXXXXXXX 240
             SSYDHNH+KRFKEM+EMHG S RD+            M K   MADA             
Sbjct:   181 SSYDHNHKKRFKEMKEMHGASGRDERKKREQQRQEREMTK---MADARKQHQMQQSQQEV 237

Query:   241 XXXXXXXSGSVSVPTAPGTTTALANQDQRKALKFGFSSKGGT-SKNTTGXXXXXXXXXXX 299
                       VS P A  T   LA QDQRK LKFGFSSK G  SK+              
Sbjct:   238 PENV-----PVSAP-AKTTVAPLAVQDQRKTLKFGFSSKSGIISKSQPTSSIKKPKVAIA 291

Query:   300 XXFGHDSDEE 309
               FG+DSDE+
Sbjct:   292 SVFGNDSDED 301




GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
ZFIN|ZDB-GENE-030131-6966 gpatch8 "G patch domain containing 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1918667 Gpatch8 "G patch domain containing 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1M1F0 LOC688211 "Protein LOC688211" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1596463 Gpatch8 "G patch domain containing 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RIL0 GPATCH8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P741 GPATCH8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UKJ3 GPATCH8 "G patch domain-containing protein 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BC37 GPATCH8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|K7EKU0 GPATCH8 "G patch domain-containing protein 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
smart0044347 smart00443, G_patch, glycine rich nucleic binding 9e-16
pfam0158545 pfam01585, G-patch, G-patch domain 3e-15
smart0045135 smart00451, ZnF_U1, U1-like zinc finger 2e-04
PRK05035 695 PRK05035, PRK05035, electron transport complex pro 0.004
>gnl|CDD|197727 smart00443, G_patch, glycine rich nucleic binding domain Back     alignment and domain information
 Score = 69.9 bits (172), Expect = 9e-16
 Identities = 26/46 (56%), Positives = 38/46 (82%), Gaps = 1/46 (2%)

Query: 64  LTSSNIGFRLLQKMGWK-GKGLGKDEQGIIEPIKSGIRDPKLGVGK 108
           +++SNIG +LL+KMGWK G+GLGK+EQGI+EPI + I+  + G+G 
Sbjct: 1   ISTSNIGAKLLRKMGWKEGQGLGKNEQGIVEPISAEIKKDRKGLGA 46


A predicted glycine rich nucleic binding domain found in the splicing factor 45, SON DNA binding protein and D-type Retrovirus- polyproteins. Length = 47

>gnl|CDD|144978 pfam01585, G-patch, G-patch domain Back     alignment and domain information
>gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 310
PF0158545 G-patch: G-patch domain; InterPro: IPR000467 The D 99.43
smart0044347 G_patch glycine rich nucleic binding domain. A pre 99.3
KOG2809326 consensus Telomerase elongation inhibitor/RNA matu 99.09
KOG0965988 consensus Predicted RNA-binding protein, contains 98.82
KOG2384223 consensus Major histocompatibility complex protein 98.7
KOG2185486 consensus Predicted RNA-processing protein, contai 98.7
PF1265677 G-patch_2: DExH-box splicing factor binding site 98.69
KOG1994268 consensus Predicted RNA binding protein, contains 98.65
KOG2184 767 consensus Tuftelin-interacting protein TIP39, cont 98.55
KOG0154573 consensus RNA-binding protein RBM5 and related pro 98.5
KOG3673 845 consensus FtsJ-like RNA methyltransferase [RNA pro 98.05
KOG4727193 consensus U1-like Zn-finger protein [General funct 97.79
KOG4368757 consensus Predicted RNA binding protein, contains 97.74
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.71
KOG1996378 consensus mRNA splicing factor [RNA processing and 97.67
KOG4315455 consensus G-patch nucleic acid binding protein [Ge 97.43
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.3
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 97.17
KOG0717508 consensus Molecular chaperone (DnaJ superfamily) [ 94.38
KOG2138 883 consensus Predicted RNA binding protein, contains 93.21
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 93.07
KOG3408129 consensus U1-like Zn-finger-containing protein, pr 91.39
KOG1994268 consensus Predicted RNA binding protein, contains 91.28
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 91.25
KOG2785 390 consensus C2H2-type Zn-finger protein [General fun 90.22
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 89.35
smart0058649 ZnF_DBF Zinc finger in DBF-like proteins. 89.16
PF0753549 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc 87.76
PF15473150 PCNP: PEST, proteolytic signal-containing nuclear 86.35
KOG0150 336 consensus Spliceosomal protein FBP21 [RNA processi 85.16
COG5188470 PRP9 Splicing factor 3a, subunit 3 [RNA processing 84.19
PLN02748468 tRNA dimethylallyltransferase 82.84
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 82.41
KOG2384223 consensus Major histocompatibility complex protein 80.68
smart0035526 ZnF_C2H2 zinc finger. 80.25
PF0622038 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi 80.02
>PF01585 G-patch: G-patch domain; InterPro: IPR000467 The D111/G-patch domain [] is a short conserved region of about 40 amino acids which occurs in a number of putative RNA-binding proteins, including tumor suppressor and DNA-damage-repair proteins, suggesting that this domain may have an RNA binding function Back     alignment and domain information
Probab=99.43  E-value=1.4e-13  Score=97.76  Aligned_cols=44  Identities=52%  Similarity=1.050  Sum_probs=42.0

Q ss_pred             CCcHHHHHHHhcCCC-CCCCCCCCCCcccceeeeecCCCccccCC
Q 021579           66 SSNIGFRLLQKMGWK-GKGLGKDEQGIIEPIKSGIRDPKLGVGKQ  109 (310)
Q Consensus        66 ~sniG~kML~KMGWk-G~GLGk~~qGi~ePI~~~~k~~~~GLGa~  109 (310)
                      ++++|++||.+|||+ |+|||++.+||++||.+..+.++.|||+.
T Consensus         1 t~~~g~~lm~kmGw~~G~GLGk~~~G~~~pi~~~~~~~~~GlG~~   45 (45)
T PF01585_consen    1 TSSIGFKLMKKMGWKPGQGLGKNGQGIAEPIEVKKKKDRKGLGAE   45 (45)
T ss_pred             CCcHHHHHHHHCCCCCCcCCCcCCccCCcceEEeeEcCCccccCC
Confidence            479999999999999 99999999999999999999999999973



This domain has seven highly conserved glycines. A multiple alignment of a small subset of D111/G-patch domains is shown in Fig. 2b of [].; GO: 0003676 nucleic acid binding, 0005622 intracellular

>smart00443 G_patch glycine rich nucleic binding domain Back     alignment and domain information
>KOG2809 consensus Telomerase elongation inhibitor/RNA maturation protein PINX1 [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0965 consensus Predicted RNA-binding protein, contains SWAP and G-patch domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>PF12656 G-patch_2: DExH-box splicing factor binding site Back     alignment and domain information
>KOG1994 consensus Predicted RNA binding protein, contains G-patch and Zn-finger domains [RNA processing and modification] Back     alignment and domain information
>KOG2184 consensus Tuftelin-interacting protein TIP39, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>KOG0154 consensus RNA-binding protein RBM5 and related proteins, contain G-patch and RRM domains [General function prediction only] Back     alignment and domain information
>KOG3673 consensus FtsJ-like RNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG4727 consensus U1-like Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4368 consensus Predicted RNA binding protein, contains SWAP, RPR and G-patch domains [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4315 consensus G-patch nucleic acid binding protein [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2138 consensus Predicted RNA binding protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] Back     alignment and domain information
>KOG1994 consensus Predicted RNA binding protein, contains G-patch and Zn-finger domains [RNA processing and modification] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins Back     alignment and domain information
>PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15473 PCNP: PEST, proteolytic signal-containing nuclear protein family Back     alignment and domain information
>KOG0150 consensus Spliceosomal protein FBP21 [RNA processing and modification] Back     alignment and domain information
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 45.6 bits (107), Expect = 1e-05
 Identities = 31/189 (16%), Positives = 63/189 (33%), Gaps = 56/189 (29%)

Query: 16  DKQPHEKEQAYQDSVIEDLAEDFRLPIHQKPIENVDLDDVEQASLDTKLTSSNIG----- 70
           D +  E +  Y+D ++    + F        ++N D  DV+     + L+   I      
Sbjct: 8   DFETGEHQYQYKD-ILSVFEDAF--------VDNFDCKDVQD-MPKSILSKEEIDHIIMS 57

Query: 71  -------FRLLQKMGWKGK---------GLGKDEQGIIEPIKSGIRDPKLGVGKQEEDDF 114
                   RL   +  K +          L  + + ++ PIK+  R P +         +
Sbjct: 58  KDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSM-----MTRMY 112

Query: 115 FTAEENIQRRKLDIEVEDTEENAKKREVLAEREQ---KIQTEVKEIRKVFYCDL-----C 166
               + +     D +V        K  V   R Q   K++  + E+R      +      
Sbjct: 113 IEQRDRLYN---DNQV------FAKYNV--SRLQPYLKLRQALLELRPAKNVLIDGVLGS 161

Query: 167 NKQYKLAVE 175
            K + +A++
Sbjct: 162 GKTW-VALD 169


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.11
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.77
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 92.39
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 91.57
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 90.12
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 90.11
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 89.08
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 88.94
1ard_A29 Yeast transcription factor ADR1; transcription reg 88.79
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 88.08
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 88.05
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 87.78
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 87.38
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 86.91
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 86.67
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 86.62
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 86.51
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.48
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.2
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 85.96
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 85.93
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 85.62
3cw1_L77 U1 small nuclear ribonucleoprotein C; PRE-mRNA spl 85.44
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.93
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.82
1paa_A30 Yeast transcription factor ADR1; transcription reg 84.66
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 84.37
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.35
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.25
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 84.24
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 83.7
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 83.57
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 83.3
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 83.05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 83.03
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 83.03
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 83.02
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 82.93
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 82.86
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 82.81
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 82.5
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 82.31
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 82.03
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 81.91
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 81.84
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 81.66
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 81.55
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 81.36
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 81.35
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 81.34
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 81.21
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 81.11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 80.89
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 80.84
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 80.79
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 80.79
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.73
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 80.64
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 80.62
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 80.57
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 80.54
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 80.46
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 80.42
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 80.18
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 80.11
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 80.06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 80.04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 80.02
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
Probab=96.11  E-value=0.0013  Score=55.19  Aligned_cols=37  Identities=24%  Similarity=0.522  Sum_probs=31.9

Q ss_pred             hhhhhhhhhhhhhhhHHHHHhhccchhhhHHHHHHHHHH
Q 021579          158 RKVFYCDLCNKQYKLAVEFEAHLSSYDHNHRKRFKEMRE  196 (310)
Q Consensus       158 rkvFyC~lCnkqy~~~~eye~Hlnsy~H~h~~Rlk~lk~  196 (310)
                      .+.|||..|++.|.+...|..|++|..|  ++|++.|+.
T Consensus        48 ekpfyC~~C~K~F~~~~~L~~H~rsK~H--Krrvk~l~~   84 (124)
T 1zr9_A           48 GGLHRCLACARYFIDSTNLKTHFRSKDH--KKRLKQLSV   84 (124)
T ss_dssp             GGCSEETTTTEECSSHHHHHHHTTCHHH--HHHHHHHTS
T ss_pred             CcceEcccCcchhCCHHHHHHHHhhhhh--hHHHHHhcc
Confidence            4689999999999999999999998765  667777764



>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 97.42
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 93.71
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 90.19
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 89.45
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 89.3
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 88.91
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 88.68
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 84.89
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 82.71
d2vrda161 Spliceosomal protein U1C {Human (Homo sapiens) [Ta 82.5
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 81.85
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 81.84
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 80.65
d2cota238 Zinc finger and SCAN domain-containing protein 16, 80.49
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: HkH motif-containing C2H2 finger
domain: Zinc finger protein 593, ZNF593
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.42  E-value=1.4e-05  Score=58.98  Aligned_cols=35  Identities=26%  Similarity=0.572  Sum_probs=31.6

Q ss_pred             hhhhhhhhhhhhhHHHHHhhccchhhhHHHHHHHHHH
Q 021579          160 VFYCDLCNKQYKLAVEFEAHLSSYDHNHRKRFKEMRE  196 (310)
Q Consensus       160 vFyC~lCnkqy~~~~eye~Hlnsy~H~h~~Rlk~lk~  196 (310)
                      -|||-.|++.|.+...|.+|++|..|  ++|++.|+.
T Consensus        15 qfYCv~C~K~F~se~~l~~H~ksKkH--Krrvk~L~~   49 (67)
T d1zr9a1          15 LHRCLACARYFIDSTNLKTHFRSKDH--KKRLKQLSV   49 (67)
T ss_dssp             CSEETTTTEECSSHHHHHHHTTCHHH--HHHHHHHTS
T ss_pred             EEecccccCccCCHHHHHHHHcccHH--HHHHHHhcc
Confidence            39999999999999999999999976  678998865



>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure