Citrus Sinensis ID: 021596


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MASKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFVVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTLEREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV
cccccEEEEEcccccHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHcccccEEEEcccccHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHccccECccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccEEEEEccccccEEEccHHHHHHHHHHHcccccccccEEEECcccccccHHHHHHHHHHHHcccEEEEEccHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHc
**SKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSA**KSQLLDHFKNLGVNFVVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTLEREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFVVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIxxxxxxxxxxxxxxxxxxxxxAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Isoflavone reductase homolog probableP52578
Isoflavone reductase-like protein probableE1U332
Isoflavone reductase Reduces achiral isoflavones to chiral isoflavanones during the biosynthesis of chiral pterocarpan phytoalexins. The reduction product is a third isomer, which represents the penultimate intermediate in the synthesis of the phytoalexin (-)-medicarpin, the major phytoalexin in Alfalfa.probableP52575

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.3.-.-Acting on the CH-CH group of donors.probable
1.3.1.-10-hydroxytaxane O-acetyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QYC, chain A
Confidence level:very confident
Coverage over the Query: 2-310
View the alignment between query and template
View the model in PyMOL