Citrus Sinensis ID: 021596


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MASKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFVVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTLEREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV
cccccEEEEEcccccHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHcccccEEEEcccccHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHccccEEccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccEEEEEccccccEEEccHHHHHHHHHHHcccccccccEEEEEcccccccHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHc
cccccEEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccEEEEEccHHHHHHHHHHHHHHHHHccccEcccccccccHHHcccccccHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHcccccccccccccccccEEEEEEcccEEEEEEcHccHEEEEEEEccccccccEEEEEccccccccHHHHHHHHHHHHcccccEEEccHHHHHHHHHcccccccEEEEEEEEEEEEccEEEEEEcccccEEEcEccccccEccHHHHHHHcc
MASKSKIlsiggtgyIGKFIVEASVKAGHPTFVLVRestlsapsksqlLDHFKNLGVNFVVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEagnvtrffpsefgndvdrahgavepaksvyYDVKARIRRAVEAegipytyvesycfdgyflpnllqpgaaapprdkvvilgdgnpkavynkeddiatytikavddprtlnknlyiqppgniysfnDLVSLWERKIGKTLEREYVSEEQLLKNiqeaappqnviLSIYHSVFmngvqtnfeiepsfgveasqlfpdvkyttVDEYLNQFV
maskskilsiggtGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFVVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEfgndvdrahgavepaksvyydvKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVILGDGnpkavynkeddiatytikavddprtlNKNLYIQPPGNIYSFNDLVSLWERKIGKTLEREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV
MASKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFVVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTLEREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV
******ILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSA**KSQLLDHFKNLGVNFVVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTLEREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYL****
**SKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRE*************HFKNLGVNFVVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTLEREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV
MASKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFVVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTLEREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV
***KSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFVVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTLEREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFVVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIxxxxxxxxxxxxxxxxxxxxxAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query310 2.2.26 [Sep-21-2011]
P52578308 Isoflavone reductase homo N/A no 0.993 1.0 0.751 1e-131
E1U332308 Isoflavone reductase-like N/A no 0.993 1.0 0.706 1e-124
P52577310 Isoflavone reductase homo no no 0.987 0.987 0.679 1e-115
P52579310 Isoflavone reductase homo N/A no 0.993 0.993 0.645 1e-112
P52580309 Isoflavone reductase homo N/A no 0.993 0.996 0.581 7e-98
P52575318 Isoflavone reductase OS=M N/A no 0.990 0.965 0.551 7e-95
P52576318 Isoflavone reductase OS=P N/A no 0.990 0.965 0.551 2e-94
Q00016318 Isoflavone reductase OS=C N/A no 0.990 0.965 0.557 2e-93
P52581312 Isoflavone reductase homo N/A no 0.980 0.974 0.466 1e-73
Q15GI3323 Isoeugenol synthase 1 OS= N/A no 0.961 0.922 0.463 2e-71
>sp|P52578|IFRH_SOLTU Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function desciption
 Score =  468 bits (1203), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/310 (75%), Positives = 264/310 (85%), Gaps = 2/310 (0%)

Query: 1   MASKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFV 60
           MA KSKIL IGGTGYIGKFIVEAS KAGH TFVLVRESTLS P+K++L+D FK+ GV FV
Sbjct: 1   MAGKSKILFIGGTGYIGKFIVEASAKAGHDTFVLVRESTLSNPTKTKLIDTFKSFGVTFV 60

Query: 61  VGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRA 120
            GD+ +HESLV AIKQVDVVISTVGHALLADQVK+IAAIKEAGNV RFFPSEFGNDVDR 
Sbjct: 61  HGDLYDHESLVKAIKQVDVVISTVGHALLADQVKLIAAIKEAGNVKRFFPSEFGNDVDRV 120

Query: 121 HGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVI 180
           H AVEPAK+ + + KA+IRR VEAEGIP+TYV ++ F GY LPNL QPGAA PP DKVVI
Sbjct: 121 H-AVEPAKAAF-NTKAQIRRVVEAEGIPFTYVATFFFAGYSLPNLAQPGAAGPPNDKVVI 178

Query: 181 LGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTL 240
           LG GN KAV+NKE+DI TYTI AVDDP+TLNK LYI+PP NI + N+LVSLWE+K GK L
Sbjct: 179 LGHGNTKAVFNKEEDIGTYTINAVDDPKTLNKILYIKPPHNIITLNELVSLWEKKTGKNL 238

Query: 241 EREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYT 300
           ER YV EEQ+LKNIQEA+ P NV LSIYH+ F+ G  TNFEIEPSFGVEAS+++PDVKYT
Sbjct: 239 ERLYVPEEQVLKNIQEASVPMNVGLSIYHTAFVKGDHTNFEIEPSFGVEASEVYPDVKYT 298

Query: 301 TVDEYLNQFV 310
            +DE LNQ+V
Sbjct: 299 PIDEILNQYV 308





Solanum tuberosum (taxid: 4113)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: -
>sp|E1U332|ALL12_OLEEU Isoflavone reductase-like protein OS=Olea europaea PE=1 SV=1 Back     alignment and function description
>sp|P52577|IFRH_ARATH Isoflavone reductase homolog P3 OS=Arabidopsis thaliana GN=At1g75280 PE=1 SV=1 Back     alignment and function description
>sp|P52579|IFRH_TOBAC Isoflavone reductase homolog A622 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P52580|IFRH_MAIZE Isoflavone reductase homolog IRL OS=Zea mays GN=IRL PE=2 SV=1 Back     alignment and function description
>sp|P52575|IFR_MEDSA Isoflavone reductase OS=Medicago sativa GN=IFR PE=1 SV=1 Back     alignment and function description
>sp|P52576|IFR_PEA Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1 Back     alignment and function description
>sp|Q00016|IFR_CICAR Isoflavone reductase OS=Cicer arietinum GN=IFR PE=1 SV=1 Back     alignment and function description
>sp|P52581|IFRH_LUPAL Isoflavone reductase homolog OS=Lupinus albus PE=2 SV=1 Back     alignment and function description
>sp|Q15GI3|IGS1_PETHY Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
3243234308 isoflavone reductase related protein [Py 0.993 1.0 0.790 1e-136
118486357306 unknown [Populus trichocarpa] 0.980 0.993 0.800 1e-135
224105373306 phenylcoumaran benzylic ether reductase 0.980 0.993 0.797 1e-134
76559894306 TPA: isoflavone reductase-like protein 5 0.987 1.0 0.770 1e-132
76559896308 TPA: isoflavone reductase-like protein 6 0.993 1.0 0.754 1e-131
225428436306 PREDICTED: isoflavone reductase homolog 0.987 1.0 0.764 1e-131
357467313312 Isoflavone reductase-like protein [Medic 0.980 0.974 0.758 1e-131
449438299308 PREDICTED: isoflavone reductase homolog 0.993 1.0 0.758 1e-131
351726399310 isoflavone reductase homolog 2 [Glycine 0.987 0.987 0.762 1e-130
255640090310 unknown [Glycine max] 0.987 0.987 0.762 1e-130
>gi|3243234|gb|AAC24001.1| isoflavone reductase related protein [Pyrus communis] Back     alignment and taxonomy information
 Score =  491 bits (1265), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 245/310 (79%), Positives = 275/310 (88%), Gaps = 2/310 (0%)

Query: 1   MASKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFV 60
           MASKS+IL IGGTGYIGKFIVEAS KAG+PT+VLVRE++LS P+KS+++++FK LGVNFV
Sbjct: 1   MASKSQILFIGGTGYIGKFIVEASAKAGYPTYVLVREASLSDPAKSKVIENFKALGVNFV 60

Query: 61  VGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRA 120
           +GD+ +HESLV AIKQVDVVISTVGH  LADQ KIIAAIKEAGNV RFFPSEFGNDVDR+
Sbjct: 61  LGDLYDHESLVKAIKQVDVVISTVGHGQLADQGKIIAAIKEAGNVKRFFPSEFGNDVDRS 120

Query: 121 HGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVI 180
           H AVEPAKS + + KA+IRRAVEAEGIPYTYV S  F GYFLP L QPGA++ PRDKVVI
Sbjct: 121 H-AVEPAKSAF-ETKAKIRRAVEAEGIPYTYVSSNFFAGYFLPTLNQPGASSAPRDKVVI 178

Query: 181 LGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTL 240
           LGDGNPKA++NKEDDI TYTI+AVDDPRTLNK LYI+PP N  SFN+LVSLWE+KIGKTL
Sbjct: 179 LGDGNPKAIFNKEDDIGTYTIRAVDDPRTLNKVLYIRPPANTISFNELVSLWEKKIGKTL 238

Query: 241 EREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYT 300
           ER YV EEQLLKNIQEAA P NVILSI H+VF+ G  TNFEIEPSFGVEA+ L+PDVKYT
Sbjct: 239 ERIYVPEEQLLKNIQEAAVPLNVILSISHAVFVKGDHTNFEIEPSFGVEATALYPDVKYT 298

Query: 301 TVDEYLNQFV 310
           TVDEYLNQFV
Sbjct: 299 TVDEYLNQFV 308




Source: Pyrus communis

Species: Pyrus communis

Genus: Pyrus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118486357|gb|ABK95019.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105373|ref|XP_002313788.1| phenylcoumaran benzylic ether reductase 3 [Populus trichocarpa] gi|222850196|gb|EEE87743.1| phenylcoumaran benzylic ether reductase 3 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|76559894|tpe|CAI56334.1| TPA: isoflavone reductase-like protein 5 [Vitis vinifera] Back     alignment and taxonomy information
>gi|76559896|tpe|CAI56335.1| TPA: isoflavone reductase-like protein 6 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225428436|ref|XP_002283953.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera] gi|297744403|emb|CBI37665.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357467313|ref|XP_003603941.1| Isoflavone reductase-like protein [Medicago truncatula] gi|355492989|gb|AES74192.1| Isoflavone reductase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449438299|ref|XP_004136926.1| PREDICTED: isoflavone reductase homolog [Cucumis sativus] gi|449478781|ref|XP_004155417.1| PREDICTED: isoflavone reductase homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|351726399|ref|NP_001237637.1| isoflavone reductase homolog 2 [Glycine max] gi|6573171|gb|AAF17578.1|AF202184_1 isoflavone reductase homolog 2 [Glycine max] Back     alignment and taxonomy information
>gi|255640090|gb|ACU20336.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
TAIR|locus:2136383308 AT4G39230 [Arabidopsis thalian 0.993 1.0 0.732 4.2e-118
TAIR|locus:2025192310 AT1G75280 [Arabidopsis thalian 0.987 0.987 0.679 1.7e-105
TAIR|locus:2025197318 AT1G75290 [Arabidopsis thalian 0.990 0.965 0.647 2.6e-102
TAIR|locus:2025167322 AT1G75300 [Arabidopsis thalian 0.970 0.934 0.618 2.6e-95
TAIR|locus:2016482310 AT1G19540 [Arabidopsis thalian 0.980 0.980 0.593 2.2e-89
TAIR|locus:2139494306 AT4G34540 [Arabidopsis thalian 0.958 0.970 0.463 2.4e-69
TAIR|locus:2031730317 PRR1 "pinoresinol reductase 1" 0.977 0.955 0.447 4.1e-65
TAIR|locus:2119455317 PRR2 "pinoresinol reductase 2" 0.980 0.958 0.442 3.8e-62
ASPGD|ASPL0000047359312 AN8968 [Emericella nidulans (t 0.783 0.778 0.263 4e-19
ASPGD|ASPL0000072559359 AN8815 [Emericella nidulans (t 0.748 0.646 0.301 1.6e-15
TAIR|locus:2136383 AT4G39230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1163 (414.5 bits), Expect = 4.2e-118, P = 4.2e-118
 Identities = 227/310 (73%), Positives = 260/310 (83%)

Query:     1 MASKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFV 60
             M SKSKIL IGGTGYIGK+IVEAS ++GHPT VLVR STL++PS+S  +++FKNLGV F+
Sbjct:     1 MTSKSKILFIGGTGYIGKYIVEASARSGHPTLVLVRNSTLTSPSRSSTIENFKNLGVQFL 60

Query:    61 VGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRA 120
             +GD+ +H SLVN+IKQ DVVISTVGH+LL  Q KII+AIKEAGNV RFFPSEFGNDVDR 
Sbjct:    61 LGDLDDHTSLVNSIKQADVVISTVGHSLLGHQYKIISAIKEAGNVKRFFPSEFGNDVDRV 120

Query:   121 HGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVI 180
                VEPAKS Y   KA+IRR +EAEGIPYTYV    F GYFLP L QPGA + PRDKV++
Sbjct:   121 F-TVEPAKSAYA-TKAKIRRTIEAEGIPYTYVSCNFFAGYFLPTLAQPGATSAPRDKVIV 178

Query:   181 LGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTL 240
             LGDGNPKAV+NKE+DI TYTI AVDDPRTLNK LYI+PP N YSFNDLVSLWE KIGKTL
Sbjct:   179 LGDGNPKAVFNKEEDIGTYTINAVDDPRTLNKILYIRPPMNTYSFNDLVSLWENKIGKTL 238

Query:   241 EREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYT 300
             ER YV EEQLLK I E++PP NV+LS+ H VF+ G  T+FEIEPSFGVEAS+L+PDVKYT
Sbjct:   239 ERIYVPEEQLLKQIIESSPPLNVMLSLCHCVFVKGGHTSFEIEPSFGVEASELYPDVKYT 298

Query:   301 TVDEYLNQFV 310
             TVDE LNQ+V
Sbjct:   299 TVDEILNQYV 308




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0032442 "phenylcoumaran benzylic ether reductase activity" evidence=ISS
GO:0046686 "response to cadmium ion" evidence=IEP
TAIR|locus:2025192 AT1G75280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025197 AT1G75290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025167 AT1G75300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016482 AT1G19540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139494 AT4G34540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031730 PRR1 "pinoresinol reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119455 PRR2 "pinoresinol reductase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000047359 AN8968 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000072559 AN8815 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P52575IFR_MEDSA1, ., 3, ., 1, ., 4, 50.55140.99030.9654N/Ano
P52576IFR_PEA1, ., 3, ., 1, ., 4, 50.55140.99030.9654N/Ano
P52579IFRH_TOBAC1, ., 3, ., 1, ., -0.64510.99350.9935N/Ano
P52580IFRH_MAIZE1, ., 3, ., 1, ., -0.58190.99350.9967N/Ano
P52578IFRH_SOLTU1, ., 3, ., 1, ., -0.75160.99351.0N/Ano
E1U332ALL12_OLEEU1, ., 3, ., 1, ., -0.70640.99351.0N/Ano
Q00016IFR_CICAR1, ., 3, ., 1, ., 4, 50.55760.99030.9654N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.3.10.963
3rd Layer1.17.1LOW CONFIDENCE prediction!
3rd Layer1.3.1.45LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
PCBER3
SubName- Full=Putative uncharacterized protein; (307 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
pfam05368232 pfam05368, NmrA, NmrA-like family 1e-96
cd05259282 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ethe 4e-77
cd05243203 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 9e-23
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 2e-21
cd05269272 cd05269, TMR_SDR_a, triphenylmethane reductase (TM 1e-19
cd05244207 cd05244, BVR-B_like_SDR_a, biliverdin IX beta redu 2e-13
pfam13460182 pfam13460, NAD_binding_10, NADH(P)-binding 5e-13
COG0702275 COG0702, COG0702, Predicted nucleoside-diphosphate 3e-12
cd05271273 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ub 2e-10
cd05265250 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 2e-09
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 5e-09
PLN02657390 PLN02657, PLN02657, 3,8-divinyl protochlorophyllid 6e-09
cd05251242 cd05251, NmrA_like_SDR_a, NmrA (a transcriptional 8e-08
cd05267203 cd05267, SDR_a6, atypical (a) SDRs, subgroup 6 6e-07
COG2910211 COG2910, COG2910, Putative NADH-flavin reductase [ 2e-06
cd05231259 cd05231, NmrA_TMR_like_1_SDR_a, NmrA (a transcript 2e-05
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 3e-05
CHL00194317 CHL00194, ycf39, Ycf39; Provisional 3e-05
cd05262291 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 5e-05
cd05245293 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2 9e-05
cd05263293 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens 1e-04
cd05247323 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, 2e-04
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 2e-04
pfam01073280 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydr 4e-04
TIGR01179328 TIGR01179, galE, UDP-glucose-4-epimerase GalE 5e-04
TIGR03466328 TIGR03466, HpnA, hopanoid-associated sugar epimera 7e-04
pfam03435380 pfam03435, Saccharop_dh, Saccharopine dehydrogenas 8e-04
cd05227301 cd05227, AR_SDR_e, aldehyde reductase, extended (e 8e-04
cd05257316 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, 0.001
cd05264300 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase 0.001
>gnl|CDD|191263 pfam05368, NmrA, NmrA-like family Back     alignment and domain information
 Score =  284 bits (729), Expect = 1e-96
 Identities = 127/237 (53%), Positives = 150/237 (63%), Gaps = 14/237 (5%)

Query: 7   ILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFVVGDVLN 66
           IL  G TGY G  +V AS+KAGHP   LVR+       KS+L    K  GV  V GD+ +
Sbjct: 1   ILVFGATGYQGGSVVRASLKAGHPVRALVRDP------KSELAKSLKAAGVELVEGDLDD 54

Query: 67  HESLVNAIKQVDVVISTVG---HALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGA 123
           HESLV A+K VDVV S  G      + D  K+  A KEAG V  F PSEFGNDVDR++G 
Sbjct: 55  HESLVEALKGVDVVFSVTGFWLSKEIEDGKKLADAAKEAG-VKHFIPSEFGNDVDRSNG- 112

Query: 124 VEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVILGD 183
           VEPA   + D KA + R + A GIPYT+V +  F G FL NL  PG  APPRDKV +LG 
Sbjct: 113 VEPAVPHF-DSKAEVERYIRALGIPYTFVYAGFFMGNFLSNLAPPGDLAPPRDKVTLLGP 171

Query: 184 GNPKAVYN-KEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKT 239
           GNPKAV    E+DI TY IK +DDPR L K  YI+PPGNI S N++  LW +KIGKT
Sbjct: 172 GNPKAVPLDDEEDIGTYVIKILDDPRKL-KGKYIRPPGNILSGNEIAELWSKKIGKT 227


NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families. Length = 232

>gnl|CDD|187569 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ether reductase (PCBER) like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187578 cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187555 cd05244, BVR-B_like_SDR_a, biliverdin IX beta reductase (BVR-B, aka flavin reductase)-like proteins; atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|222146 pfam13460, NAD_binding_10, NADH(P)-binding Back     alignment and domain information
>gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178263 PLN02657, PLN02657, 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>gnl|CDD|187561 cd05251, NmrA_like_SDR_a, NmrA (a transcriptional regulator) and HSCARG (an NADPH sensor) like proteins, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187577 cd05267, SDR_a6, atypical (a) SDRs, subgroup 6 Back     alignment and domain information
>gnl|CDD|225462 COG2910, COG2910, Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|187542 cd05231, NmrA_TMR_like_1_SDR_a, NmrA (a transcriptional regulator) and triphenylmethane reductase (TMR) like proteins, subgroup 1, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|177093 CHL00194, ycf39, Ycf39; Provisional Back     alignment and domain information
>gnl|CDD|187572 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 Back     alignment and domain information
>gnl|CDD|187556 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2 Back     alignment and domain information
>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|217556 pfam03435, Saccharop_dh, Saccharopine dehydrogenase Back     alignment and domain information
>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187574 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase (G4E), subgroup 5, extended (e) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 310
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 100.0
CHL00194317 ycf39 Ycf39; Provisional 100.0
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 100.0
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.98
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.97
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.97
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.97
PLN02427386 UDP-apiose/xylose synthase 99.97
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.97
PLN00016378 RNA-binding protein; Provisional 99.97
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.96
PLN02206442 UDP-glucuronate decarboxylase 99.96
PLN02166436 dTDP-glucose 4,6-dehydratase 99.96
PLN02214342 cinnamoyl-CoA reductase 99.96
PLN02572442 UDP-sulfoquinovose synthase 99.96
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.96
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.96
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.96
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.96
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.96
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.96
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.96
PLN02240352 UDP-glucose 4-epimerase 99.96
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.95
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.95
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.95
PLN02686367 cinnamoyl-CoA reductase 99.95
PLN02260 668 probable rhamnose biosynthetic enzyme 99.95
PLN02653340 GDP-mannose 4,6-dehydratase 99.95
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.95
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.95
PLN00198338 anthocyanidin reductase; Provisional 99.95
PLN02650351 dihydroflavonol-4-reductase 99.95
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.95
PRK07201 657 short chain dehydrogenase; Provisional 99.94
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.94
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.94
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.94
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.94
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.94
PRK05865 854 hypothetical protein; Provisional 99.93
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.93
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.93
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.93
PLN02583297 cinnamoyl-CoA reductase 99.93
PLN02996491 fatty acyl-CoA reductase 99.93
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.93
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.93
PLN02896353 cinnamyl-alcohol dehydrogenase 99.93
PLN02778298 3,5-epimerase/4-reductase 99.93
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 99.92
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.92
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 99.92
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 99.92
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.92
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.92
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.91
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.9
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 99.9
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.9
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.9
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.89
PLN03209 576 translocon at the inner envelope of chloroplast su 99.89
PLN02503605 fatty acyl-CoA reductase 2 99.88
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.88
PRK12320 699 hypothetical protein; Provisional 99.87
PLN02260668 probable rhamnose biosynthetic enzyme 99.86
PRK06482276 short chain dehydrogenase; Provisional 99.86
COG2910211 Putative NADH-flavin reductase [General function p 99.84
PRK08263275 short chain dehydrogenase; Provisional 99.84
PRK07806248 short chain dehydrogenase; Provisional 99.83
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.82
PRK06180277 short chain dehydrogenase; Provisional 99.82
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.81
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.81
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.8
PRK06182273 short chain dehydrogenase; Validated 99.8
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.8
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.79
PRK07074257 short chain dehydrogenase; Provisional 99.79
PRK05875276 short chain dehydrogenase; Provisional 99.79
PRK07825273 short chain dehydrogenase; Provisional 99.78
PRK09291257 short chain dehydrogenase; Provisional 99.77
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.77
PRK06179270 short chain dehydrogenase; Provisional 99.77
PRK05993277 short chain dehydrogenase; Provisional 99.77
PRK12828239 short chain dehydrogenase; Provisional 99.77
PRK06914280 short chain dehydrogenase; Provisional 99.76
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.76
COG3320382 Putative dehydrogenase domain of multifunctional n 99.76
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.76
PRK12746254 short chain dehydrogenase; Provisional 99.76
PRK10538248 malonic semialdehyde reductase; Provisional 99.76
PRK08219227 short chain dehydrogenase; Provisional 99.76
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.75
PRK09135249 pteridine reductase; Provisional 99.75
PRK06194287 hypothetical protein; Provisional 99.75
PRK05876275 short chain dehydrogenase; Provisional 99.75
PRK06138252 short chain dehydrogenase; Provisional 99.75
PRK08017256 oxidoreductase; Provisional 99.75
PRK07775274 short chain dehydrogenase; Provisional 99.75
PRK07067257 sorbitol dehydrogenase; Provisional 99.75
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.74
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.74
PRK12829264 short chain dehydrogenase; Provisional 99.74
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.73
PRK12827249 short chain dehydrogenase; Provisional 99.73
PRK09186256 flagellin modification protein A; Provisional 99.73
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.72
PRK07060245 short chain dehydrogenase; Provisional 99.72
PRK05650270 short chain dehydrogenase; Provisional 99.71
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 99.71
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.71
PRK07454241 short chain dehydrogenase; Provisional 99.71
PRK07326237 short chain dehydrogenase; Provisional 99.71
PRK12744257 short chain dehydrogenase; Provisional 99.71
PRK06841255 short chain dehydrogenase; Provisional 99.71
PRK06181263 short chain dehydrogenase; Provisional 99.7
PRK12939250 short chain dehydrogenase; Provisional 99.7
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.7
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.7
COG0300265 DltE Short-chain dehydrogenases of various substra 99.7
PRK07577234 short chain dehydrogenase; Provisional 99.69
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.69
PRK06128300 oxidoreductase; Provisional 99.69
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.68
PRK07904253 short chain dehydrogenase; Provisional 99.68
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.68
PRK09134258 short chain dehydrogenase; Provisional 99.68
PRK07774250 short chain dehydrogenase; Provisional 99.68
PRK07102243 short chain dehydrogenase; Provisional 99.68
PRK07109334 short chain dehydrogenase; Provisional 99.68
PRK07024257 short chain dehydrogenase; Provisional 99.68
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.67
PRK08265261 short chain dehydrogenase; Provisional 99.67
PRK08267260 short chain dehydrogenase; Provisional 99.67
PRK08324681 short chain dehydrogenase; Validated 99.67
PRK07041230 short chain dehydrogenase; Provisional 99.67
PRK07890258 short chain dehydrogenase; Provisional 99.67
PRK08628258 short chain dehydrogenase; Provisional 99.66
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.66
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.66
PRK07814263 short chain dehydrogenase; Provisional 99.66
PRK05693274 short chain dehydrogenase; Provisional 99.66
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.66
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.66
PRK06398258 aldose dehydrogenase; Validated 99.66
PRK12937245 short chain dehydrogenase; Provisional 99.66
PRK05717255 oxidoreductase; Validated 99.66
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.65
PRK06196315 oxidoreductase; Provisional 99.65
PRK12743256 oxidoreductase; Provisional 99.65
PRK08251248 short chain dehydrogenase; Provisional 99.65
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 99.65
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 99.65
PRK05866293 short chain dehydrogenase; Provisional 99.65
PRK08226263 short chain dehydrogenase; Provisional 99.65
PRK06701290 short chain dehydrogenase; Provisional 99.65
PRK07478254 short chain dehydrogenase; Provisional 99.65
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.65
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.64
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.64
PRK06500249 short chain dehydrogenase; Provisional 99.64
PRK08643256 acetoin reductase; Validated 99.64
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.64
PRK08264238 short chain dehydrogenase; Validated 99.64
PRK06101240 short chain dehydrogenase; Provisional 99.64
PRK07069251 short chain dehydrogenase; Validated 99.64
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.63
PLN02253280 xanthoxin dehydrogenase 99.63
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.63
PRK12747252 short chain dehydrogenase; Provisional 99.63
PRK08589272 short chain dehydrogenase; Validated 99.63
PRK07063260 short chain dehydrogenase; Provisional 99.62
PRK06123248 short chain dehydrogenase; Provisional 99.62
PRK06114254 short chain dehydrogenase; Provisional 99.62
PRK06523260 short chain dehydrogenase; Provisional 99.62
PRK08339263 short chain dehydrogenase; Provisional 99.62
PRK06924251 short chain dehydrogenase; Provisional 99.62
PRK06172253 short chain dehydrogenase; Provisional 99.62
PRK07035252 short chain dehydrogenase; Provisional 99.62
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.62
PRK06139330 short chain dehydrogenase; Provisional 99.62
PRK07985294 oxidoreductase; Provisional 99.62
PRK07856252 short chain dehydrogenase; Provisional 99.62
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.61
PRK06057255 short chain dehydrogenase; Provisional 99.61
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.61
PRK06947248 glucose-1-dehydrogenase; Provisional 99.61
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.6
PRK12742237 oxidoreductase; Provisional 99.6
PRK05867253 short chain dehydrogenase; Provisional 99.6
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.6
PRK07832272 short chain dehydrogenase; Provisional 99.6
PRK09242257 tropinone reductase; Provisional 99.59
PRK07023243 short chain dehydrogenase; Provisional 99.59
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.59
PRK09072263 short chain dehydrogenase; Provisional 99.59
PRK06483236 dihydromonapterin reductase; Provisional 99.59
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.58
PRK06949258 short chain dehydrogenase; Provisional 99.58
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.58
PRK08703239 short chain dehydrogenase; Provisional 99.58
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.58
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.58
PRK08278273 short chain dehydrogenase; Provisional 99.57
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.56
PRK08177225 short chain dehydrogenase; Provisional 99.56
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.56
PRK08936261 glucose-1-dehydrogenase; Provisional 99.55
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.55
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.55
PRK06198260 short chain dehydrogenase; Provisional 99.55
PRK08277278 D-mannonate oxidoreductase; Provisional 99.55
PRK07576264 short chain dehydrogenase; Provisional 99.54
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.54
PRK06197306 short chain dehydrogenase; Provisional 99.54
PRK05855582 short chain dehydrogenase; Validated 99.54
PRK07831262 short chain dehydrogenase; Provisional 99.54
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.53
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.53
PRK05872296 short chain dehydrogenase; Provisional 99.53
PRK06484520 short chain dehydrogenase; Validated 99.53
PRK07677252 short chain dehydrogenase; Provisional 99.52
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.52
PRK07062265 short chain dehydrogenase; Provisional 99.52
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.51
PRK06125259 short chain dehydrogenase; Provisional 99.51
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 99.5
PRK06953222 short chain dehydrogenase; Provisional 99.5
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.5
PRK12367245 short chain dehydrogenase; Provisional 99.5
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.5
PRK07201657 short chain dehydrogenase; Provisional 99.5
PRK05599246 hypothetical protein; Provisional 99.49
PRK05884223 short chain dehydrogenase; Provisional 99.48
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 99.48
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.48
KOG2774366 consensus NAD dependent epimerase [General functio 99.48
PRK09009235 C factor cell-cell signaling protein; Provisional 99.47
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.47
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.47
PLN02780320 ketoreductase/ oxidoreductase 99.46
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.46
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.46
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.46
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.46
PRK07578199 short chain dehydrogenase; Provisional 99.46
PRK07791286 short chain dehydrogenase; Provisional 99.46
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.45
PRK06940275 short chain dehydrogenase; Provisional 99.45
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.45
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.45
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.45
PRK08340259 glucose-1-dehydrogenase; Provisional 99.45
PRK05854313 short chain dehydrogenase; Provisional 99.44
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.44
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.42
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.42
PRK06484 520 short chain dehydrogenase; Validated 99.41
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.41
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.4
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.39
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.39
PRK08303305 short chain dehydrogenase; Provisional 99.38
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 99.34
KOG4288283 consensus Predicted oxidoreductase [General functi 99.33
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.32
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 99.31
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.31
PRK08862227 short chain dehydrogenase; Provisional 99.3
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 99.3
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.29
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 99.26
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.24
KOG1208314 consensus Dehydrogenases with different specificit 99.2
KOG1611249 consensus Predicted short chain-type dehydrogenase 99.18
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 99.14
PRK08309177 short chain dehydrogenase; Provisional 99.13
PLN00015308 protochlorophyllide reductase 99.11
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 99.1
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 99.09
COG1028251 FabG Dehydrogenases with different specificities ( 99.08
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 99.08
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.07
KOG0725270 consensus Reductases with broad range of substrate 99.07
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.04
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 98.98
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 98.91
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 98.81
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.8
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.79
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 98.76
PRK06720169 hypothetical protein; Provisional 98.72
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 98.71
PTZ00325321 malate dehydrogenase; Provisional 98.71
PLN00106323 malate dehydrogenase 98.66
KOG2733 423 consensus Uncharacterized membrane protein [Functi 98.59
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.59
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 98.53
PRK09620229 hypothetical protein; Provisional 98.53
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 98.53
PRK06732229 phosphopantothenate--cysteine ligase; Validated 98.52
COG3268382 Uncharacterized conserved protein [Function unknow 98.39
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 98.39
COG0569225 TrkA K+ transport systems, NAD-binding component [ 98.38
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 98.33
KOG1478341 consensus 3-keto sterol reductase [Lipid transport 98.31
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 98.29
PRK05086312 malate dehydrogenase; Provisional 98.25
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 98.24
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 98.19
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 98.18
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 98.17
PRK09496 453 trkA potassium transporter peripheral membrane com 98.16
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 98.16
COG0623259 FabI Enoyl-[acyl-carrier-protein] 98.12
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 98.12
PRK14982340 acyl-ACP reductase; Provisional 98.11
PRK04148134 hypothetical protein; Provisional 98.11
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 98.09
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 98.04
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 98.04
PRK12548289 shikimate 5-dehydrogenase; Provisional 98.03
PF02571249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 98.03
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.99
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 97.97
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 97.91
PRK00048257 dihydrodipicolinate reductase; Provisional 97.9
KOG0172 445 consensus Lysine-ketoglutarate reductase/saccharop 97.9
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 97.89
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.85
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 97.84
PLN02383344 aspartate semialdehyde dehydrogenase 97.83
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.79
PRK09496453 trkA potassium transporter peripheral membrane com 97.79
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 97.76
PRK08040336 putative semialdehyde dehydrogenase; Provisional 97.73
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.71
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 97.69
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 97.67
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 97.66
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.63
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.63
PRK03659601 glutathione-regulated potassium-efflux system prot 97.62
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.61
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 97.61
PRK10669558 putative cation:proton antiport protein; Provision 97.59
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 97.58
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 97.55
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 97.52
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 97.49
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 97.48
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 97.47
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 97.47
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 97.45
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 97.42
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 97.41
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 97.41
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 97.37
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.37
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.36
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 97.35
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 97.34
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.33
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 97.29
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 97.29
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 97.29
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 97.29
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.29
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.27
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.25
PRK05442326 malate dehydrogenase; Provisional 97.24
PRK08655 437 prephenate dehydrogenase; Provisional 97.23
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.22
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.21
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 97.21
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 97.21
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.2
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 97.18
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 97.18
PRK03562621 glutathione-regulated potassium-efflux system prot 97.16
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 97.16
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 97.15
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 97.13
PRK08818370 prephenate dehydrogenase; Provisional 97.13
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.13
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 97.13
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 97.12
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 97.11
PRK08223287 hypothetical protein; Validated 97.09
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.08
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.07
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.06
PRK06223307 malate dehydrogenase; Reviewed 97.06
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.04
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 97.04
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 97.03
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.03
PRK06849389 hypothetical protein; Provisional 97.02
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.01
PRK13303265 L-aspartate dehydrogenase; Provisional 97.01
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.01
cd01483143 E1_enzyme_family Superfamily of activating enzymes 97.0
TIGR00036266 dapB dihydrodipicolinate reductase. 96.99
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.99
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.98
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 96.98
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 96.97
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 96.97
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.97
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 96.96
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 96.95
PLN02928347 oxidoreductase family protein 96.95
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 96.94
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 96.94
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.93
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.92
PRK10537393 voltage-gated potassium channel; Provisional 96.92
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 96.92
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.9
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 96.9
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 96.88
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 96.88
PRK08229341 2-dehydropantoate 2-reductase; Provisional 96.88
PRK07417279 arogenate dehydrogenase; Reviewed 96.88
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 96.87
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 96.86
PRK07574385 formate dehydrogenase; Provisional 96.85
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 96.85
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 96.84
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.84
PRK05447385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 96.84
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 96.83
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.82
PRK13940414 glutamyl-tRNA reductase; Provisional 96.81
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 96.8
PLN02688266 pyrroline-5-carboxylate reductase 96.78
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 96.78
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.77
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.77
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 96.76
PRK12480330 D-lactate dehydrogenase; Provisional 96.76
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.76
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 96.75
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.75
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 96.75
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 96.75
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.74
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 96.72
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 96.71
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 96.71
PRK06436303 glycerate dehydrogenase; Provisional 96.71
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.7
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 96.7
PLN00203519 glutamyl-tRNA reductase 96.68
PRK06444197 prephenate dehydrogenase; Provisional 96.68
PRK08300302 acetaldehyde dehydrogenase; Validated 96.68
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 96.68
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.68
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 96.67
PRK12921305 2-dehydropantoate 2-reductase; Provisional 96.67
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 96.66
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.66
PLN02602350 lactate dehydrogenase 96.66
PTZ00082321 L-lactate dehydrogenase; Provisional 96.66
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.66
PLN02353 473 probable UDP-glucose 6-dehydrogenase 96.66
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.64
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 96.64
KOG4022236 consensus Dihydropteridine reductase DHPR/QDPR [Am 96.64
PRK07502307 cyclohexadienyl dehydrogenase; Validated 96.64
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.63
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.62
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.62
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 96.6
PRK06719157 precorrin-2 dehydrogenase; Validated 96.6
PRK15059292 tartronate semialdehyde reductase; Provisional 96.59
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 96.59
PRK08328231 hypothetical protein; Provisional 96.59
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.57
PRK13403335 ketol-acid reductoisomerase; Provisional 96.57
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 96.56
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 96.55
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 96.54
PRK13243333 glyoxylate reductase; Reviewed 96.53
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 96.52
PRK14027283 quinate/shikimate dehydrogenase; Provisional 96.51
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2 96.51
KOG1494345 consensus NAD-dependent malate dehydrogenase [Ener 96.49
PLN03139386 formate dehydrogenase; Provisional 96.49
PLN02775286 Probable dihydrodipicolinate reductase 96.48
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.48
PLN00112444 malate dehydrogenase (NADP); Provisional 96.47
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.47
PF1008797 DUF2325: Uncharacterized protein conserved in bact 96.45
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.45
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
Probab=100.00  E-value=4.5e-36  Score=254.71  Aligned_cols=268  Identities=20%  Similarity=0.287  Sum_probs=207.1

Q ss_pred             eEEEEccCcchhHHHHHHHHhCCCCEEEEEcCCCCCCCchhhHhHhhhcCCcEEEEccCCCHHHHHHHh------cC-CC
Q 021596            6 KILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFVVGDVLNHESLVNAI------KQ-VD   78 (310)
Q Consensus         6 ~IlI~GatG~iG~~l~~~L~~~g~~V~~~~R~~~~~~~~~~~~~~~l~~~~~~~v~~D~~d~~~~~~~~------~~-~d   78 (310)
                      +|+||||||++|++++++|+++|++|++++|+.++.           ...+++.+.+|+.|++++.+++      ++ +|
T Consensus         1 ~ilVtGatG~iG~~vv~~L~~~g~~V~~~~R~~~~~-----------~~~~~~~~~~d~~d~~~l~~a~~~~~~~~g~~d   69 (285)
T TIGR03649         1 TILLTGGTGKTASRIARLLQAASVPFLVASRSSSSS-----------AGPNEKHVKFDWLDEDTWDNPFSSDDGMEPEIS   69 (285)
T ss_pred             CEEEEcCCChHHHHHHHHHHhCCCcEEEEeCCCccc-----------cCCCCccccccCCCHHHHHHHHhcccCcCCcee
Confidence            589999999999999999999999999999995432           1347888899999999999999      57 99


Q ss_pred             EEEEcccchh--hhhHHHHHHHHHHcCCccEEcc-CCCCCCccccCCCCCCcchhhHHHHHHHHHHHHHc-CCCEEEEec
Q 021596           79 VVISTVGHAL--LADQVKIIAAIKEAGNVTRFFP-SEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAE-GIPYTYVES  154 (310)
Q Consensus        79 ~Vi~~a~~~~--~~~~~~~~~aa~~~~~v~~~v~-s~~~~~~~~~~~~~~~~~~~y~~~K~~~e~~l~~~-~~~~~i~rp  154 (310)
                      .|+++++...  .....+++++|+++| ++|||+ |+.+....      .       ..+...++++++. +++++++||
T Consensus        70 ~v~~~~~~~~~~~~~~~~~i~aa~~~g-v~~~V~~Ss~~~~~~------~-------~~~~~~~~~l~~~~gi~~tilRp  135 (285)
T TIGR03649        70 AVYLVAPPIPDLAPPMIKFIDFARSKG-VRRFVLLSASIIEKG------G-------PAMGQVHAHLDSLGGVEYTVLRP  135 (285)
T ss_pred             EEEEeCCCCCChhHHHHHHHHHHHHcC-CCEEEEeeccccCCC------C-------chHHHHHHHHHhccCCCEEEEec
Confidence            9999988543  456789999999999 999998 54433210      0       1234567788885 999999999


Q ss_pred             ceeccccccccCCCCCCCCCCCeEEEecCCCceeEeeccchHHHHHHHHhcCCccCCceEEEcCCCCccCHHHHHHHHHH
Q 021596          155 YCFDGYFLPNLLQPGAAAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWER  234 (310)
Q Consensus       155 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~D~a~~~~~~l~~~~~~~~~~~~~~~~~~~s~~e~~~~~~~  234 (310)
                      ++|++++...+.....  ...+. ...+.++.+++|++++|+|++++.++.++...++.|++.+++ .+|+.|+++.+++
T Consensus       136 ~~f~~~~~~~~~~~~~--~~~~~-~~~~~g~~~~~~v~~~Dva~~~~~~l~~~~~~~~~~~l~g~~-~~s~~eia~~l~~  211 (285)
T TIGR03649       136 TWFMENFSEEFHVEAI--RKENK-IYSATGDGKIPFVSADDIARVAYRALTDKVAPNTDYVVLGPE-LLTYDDVAEILSR  211 (285)
T ss_pred             cHHhhhhccccccccc--ccCCe-EEecCCCCccCcccHHHHHHHHHHHhcCCCcCCCeEEeeCCc-cCCHHHHHHHHHH
Confidence            9999886432211110  12233 334567888999999999999999998876677889998765 8999999999999


Q ss_pred             HhCCCceeeecCHHHHHHHHHhcCCCcchh--HHhhhheeEecccccccCCCCccccccccCCCCcccCHHHHHHhh
Q 021596          235 KIGKTLEREYVSEEQLLKNIQEAAPPQNVI--LSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQF  309 (310)
Q Consensus       235 ~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~p~~~~~~~~e~l~~~  309 (310)
                      .+|+++++..+|.+++.+.+...++|.+..  +..++.....|....  .    +....+. .|.+|+||+||+++.
T Consensus       212 ~~g~~v~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~g~~~~--~----~~~~~~~-~G~~p~~~~~~~~~~  281 (285)
T TIGR03649       212 VLGRKITHVKLTEEELAQRLQSFGMPEDLARMLASLDTAVKNGAEVR--L----NDVVKAV-TGSKPRGFRDFAESN  281 (285)
T ss_pred             HhCCceEEEeCCHHHHHHHHHHcCCCHHHHHHHHHHHHHHhCCcccc--c----cchHHHH-hCcCCccHHHHHHHh
Confidence            999999999999999999998888988765  334444444444211  1    1233344 499999999999975



This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.

>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>KOG0172 consensus Lysine-ketoglutarate reductase/saccharopine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
1qyc_A308 Crystal Structures Of Pinoresinol-Lariciresinol And 1e-111
2gas_A307 Crystal Structure Of Isoflavone Reductase Length = 6e-97
1qyd_A313 Crystal Structures Of Pinoresinol-Lariciresinol And 8e-80
3c1o_A321 The Multiple Phenylpropene Synthases In Both Clarki 9e-70
2qw8_A314 Structure Of Eugenol Synthase From Ocimum Basilicum 1e-63
2qx7_A318 Structure Of Eugenol Synthase From Ocimum Basilicum 1e-63
2r2g_A318 Structure Of Eugenol Synthase From Ocimum Basilicum 3e-63
3c3x_A318 The Multiple Phenylpropene Synthases In Both Clarki 7e-63
3i52_A346 Ternary Complex Structure Of Leucoanthocyanidin Red 3e-60
>pdb|1QYC|A Chain A, Crystal Structures Of Pinoresinol-Lariciresinol And Phenylcoumaran Benzylic Ether Reductases, And Their Relationship To Isoflavone Reductases Length = 308 Back     alignment and structure

Iteration: 1

Score = 397 bits (1020), Expect = e-111, Method: Compositional matrix adjust. Identities = 201/311 (64%), Positives = 242/311 (77%), Gaps = 4/311 (1%) Query: 1 MASKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPS-KSQLLDHFKNLGVNF 59 M S+S+IL IG TGYIG+ + +AS+ GHPTF+LVREST S+ S K+QLL+ FK G N Sbjct: 1 MGSRSRILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASGANI 60 Query: 60 VVGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDR 119 V G + +H SLV A+K VDVVISTVG + QV II AIKE G V RFFPSEFGNDVD Sbjct: 61 VHGSIDDHASLVEAVKNVDVVISTVGSLQIESQVNIIKAIKEVGTVKRFFPSEFGNDVDN 120 Query: 120 AHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVV 179 H AVEPAKSV+ +VKA++RRA+EAEGIPYTYV S CF GYFL +L Q G APPRDKVV Sbjct: 121 VH-AVEPAKSVF-EVKAKVRRAIEAEGIPYTYVSSNCFAGYFLRSLAQAGLTAPPRDKVV 178 Query: 180 ILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKT 239 ILGDGN + V+ KE+DI T+TIKAVDDPRTLNK LY++ P N S N+LV+LWE+KI KT Sbjct: 179 ILGDGNARVVFVKEEDIGTFTIKAVDDPRTLNKTLYLRLPANTLSLNELVALWEKKIDKT 238 Query: 240 LEREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKY 299 LE+ YV EE++LK I + P N+ ++I HS+F+ G QTNFEI P+ GVEASQL+PDVKY Sbjct: 239 LEKAYVPEEEVLKLIADTPFPANISIAISHSIFVKGDQTNFEIGPA-GVEASQLYPDVKY 297 Query: 300 TTVDEYLNQFV 310 TTVDEYL+ FV Sbjct: 298 TTVDEYLSNFV 308
>pdb|2GAS|A Chain A, Crystal Structure Of Isoflavone Reductase Length = 307 Back     alignment and structure
>pdb|1QYD|A Chain A, Crystal Structures Of Pinoresinol-Lariciresinol And Phenylcoumaran Benzylic Ether Reductases, And Their Relationship To Isoflavone Reductases Length = 313 Back     alignment and structure
>pdb|3C1O|A Chain A, The Multiple Phenylpropene Synthases In Both Clarkia Breweri And Petunia Hybrida Represent Two Distinct Lineages Length = 321 Back     alignment and structure
>pdb|2QW8|A Chain A, Structure Of Eugenol Synthase From Ocimum Basilicum Length = 314 Back     alignment and structure
>pdb|2QX7|A Chain A, Structure Of Eugenol Synthase From Ocimum Basilicum Length = 318 Back     alignment and structure
>pdb|2R2G|A Chain A, Structure Of Eugenol Synthase From Ocimum Basilicum Complexed With Emdf Length = 318 Back     alignment and structure
>pdb|3C3X|A Chain A, The Multiple Phenylpropene Synthases In Both Clarkia Breweri And Petunia Hybrida Represent Two Distinct Lineages Length = 318 Back     alignment and structure
>pdb|3I52|A Chain A, Ternary Complex Structure Of Leucoanthocyanidin Reductase From Vitis Vinifera Length = 346 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 1e-128
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 1e-128
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 1e-126
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 1e-124
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 1e-122
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 1e-118
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 5e-28
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 3e-21
2wm3_A299 NMRA-like family domain containing protein 1; unkn 1e-20
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 3e-20
1xq6_A253 Unknown protein; structural genomics, protein stru 8e-19
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 3e-18
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 1e-17
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 1e-17
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 2e-17
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 2e-17
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 1e-16
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 2e-14
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 9e-13
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 1e-12
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 7e-12
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 3e-08
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 4e-08
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 1e-06
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 2e-06
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 2e-06
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 6e-06
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 7e-06
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 7e-06
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 1e-05
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 3e-05
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 5e-05
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 6e-05
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 1e-04
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 1e-04
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 1e-04
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 1e-04
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 2e-04
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 2e-04
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 4e-04
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Length = 307 Back     alignment and structure
 Score =  368 bits (945), Expect = e-128
 Identities = 175/310 (56%), Positives = 235/310 (75%), Gaps = 5/310 (1%)

Query: 3   SKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSA--PSKSQLLDHFKNLGVNFV 60
           +++KIL +G TG IG+ IV AS+KAG+PT+ LVR++  +A   +K +L+D++++LGV  +
Sbjct: 1   TENKILILGPTGAIGRHIVWASIKAGNPTYALVRKTITAANPETKEELIDNYQSLGVILL 60

Query: 61  VGDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRA 120
            GD+ +HE+LV AIKQVD+VI   G  L+ DQVKII AIKEAGNV +FFPSEFG DVDR 
Sbjct: 61  EGDINDHETLVKAIKQVDIVICAAGRLLIEDQVKIIKAIKEAGNVKKFFPSEFGLDVDR- 119

Query: 121 HGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVI 180
           H AVEP + V+ + KA IRR +EAEG+PYTY+  + F GYFL NL Q  A  PPRDKVVI
Sbjct: 120 HDAVEPVRQVF-EEKASIRRVIEAEGVPYTYLCCHAFTGYFLRNLAQLDATDPPRDKVVI 178

Query: 181 LGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTL 240
           LGDGN K  Y  E D+ T+TI+A +DP TLNK ++I+ P N  + N++++LWE+KIGKTL
Sbjct: 179 LGDGNVKGAYVTEADVGTFTIRAANDPNTLNKAVHIRLPKNYLTQNEVIALWEKKIGKTL 238

Query: 241 EREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYT 300
           E+ YVSEEQ+LK+IQE++ P N +L++YHS  + G    +EI+P+  +EAS+ +PDV YT
Sbjct: 239 EKTYVSEEQVLKDIQESSFPHNYLLALYHSQQIKG-DAVYEIDPAKDIEASEAYPDVTYT 297

Query: 301 TVDEYLNQFV 310
           T DEYLNQFV
Sbjct: 298 TADEYLNQFV 307


>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Length = 346 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Length = 321 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Length = 318 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Length = 206 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Length = 299 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Length = 236 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Length = 287 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Length = 289 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Length = 352 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 3r14_A* Length = 221 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Length = 286 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Length = 224 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 215 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Length = 450 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Length = 344 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Length = 118 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Length = 322 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Length = 342 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Length = 337 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Length = 467 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Length = 236 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Length = 338 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 100.0
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 100.0
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 100.0
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 100.0
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 100.0
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 100.0
2wm3_A299 NMRA-like family domain containing protein 1; unkn 100.0
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 100.0
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 100.0
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 100.0
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 100.0
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 100.0
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 100.0
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 100.0
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 100.0
3slg_A372 PBGP3 protein; structural genomics, seattle struct 100.0
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 100.0
3ius_A286 Uncharacterized conserved protein; APC63810, silic 100.0
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 100.0
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 100.0
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 100.0
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 100.0
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 100.0
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.98
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.98
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.98
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.98
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.98
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.98
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.98
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.98
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.97
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.97
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.97
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.97
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.97
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.97
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.97
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.97
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.97
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.97
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.97
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.97
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.97
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.97
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.97
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.97
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.97
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.97
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.97
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.96
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.96
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.96
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.96
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.96
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.96
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.96
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.96
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.96
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.96
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.96
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.96
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.96
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.96
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.96
1xq6_A253 Unknown protein; structural genomics, protein stru 99.96
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.95
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.95
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.95
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.95
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.95
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.95
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.95
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.95
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.95
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.95
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.94
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.94
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.94
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.94
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.94
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.94
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.94
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.94
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.93
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.93
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.93
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.93
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.91
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.88
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.87
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.87
1spx_A278 Short-chain reductase family member (5L265); paral 99.85
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.84
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.84
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.83
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.83
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.83
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.83
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.83
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.82
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.82
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.82
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.82
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.82
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.82
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.82
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.82
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.82
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.82
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.82
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.82
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.81
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.81
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.81
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.81
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.81
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.81
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.81
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.81
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.81
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.81
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.81
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.8
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.8
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.8
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.8
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.8
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.8
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.8
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.8
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.8
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.8
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.8
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.8
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.79
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.79
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.79
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.79
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.79
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.79
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.79
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.79
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.79
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.79
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.79
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.79
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.79
3cxt_A291 Dehydrogenase with different specificities; rossma 99.79
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.79
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.78
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.78
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.78
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.78
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.78
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.78
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.78
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.78
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.78
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.78
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.78
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.78
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.78
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.78
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.78
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.78
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.78
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.77
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.77
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.77
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.77
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.77
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.77
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.77
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.77
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.77
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.77
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.77
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.77
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.76
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.76
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.76
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.76
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.76
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.76
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.76
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.76
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.76
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.76
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.76
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.76
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.76
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.76
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.76
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.76
3rih_A293 Short chain dehydrogenase or reductase; structural 99.76
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.76
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.76
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.75
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.75
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.75
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.75
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.75
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.75
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.75
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.75
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.75
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.75
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.75
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.75
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.75
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.75
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.75
4e4y_A244 Short chain dehydrogenase family protein; structur 99.75
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.74
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.74
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.74
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.74
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.74
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.74
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.74
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.74
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.74
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.74
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.74
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.73
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.73
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.73
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.73
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.73
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.73
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.73
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.73
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.73
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.73
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.73
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.73
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.73
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.73
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.73
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.73
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.73
1xkq_A280 Short-chain reductase family member (5D234); parra 99.73
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.73
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.72
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.72
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.72
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.72
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.72
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.71
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.71
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.71
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.71
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.71
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.71
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.71
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.71
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.7
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.7
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.7
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.7
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.7
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.69
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.69
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.69
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.69
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.69
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.69
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.69
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.69
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.68
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.68
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.68
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.68
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.67
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.67
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.67
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.67
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.66
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.66
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.66
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.64
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.64
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.64
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.63
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.63
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.62
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.61
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 99.61
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.6
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.6
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.58
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.56
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.55
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.55
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.54
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.53
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.51
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 99.5
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.43
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.35
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.31
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.29
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.26
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.25
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.21
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.21
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.19
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 99.12
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.11
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.08
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 99.06
1id1_A153 Putative potassium channel protein; RCK domain, E. 99.0
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 99.0
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 98.99
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 98.99
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.98
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 98.96
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.94
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 98.91
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 98.88
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 98.88
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 98.88
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.87
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.86
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 98.84
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.74
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 98.73
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.71
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.69
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 98.6
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 98.53
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 98.44
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 98.44
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 98.42
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 98.35
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 98.34
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.32
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 98.28
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 98.23
1lnq_A336 MTHK channels, potassium channel related protein; 98.21
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 98.2
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 98.17
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 98.14
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 98.13
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 98.12
4g65_A 461 TRK system potassium uptake protein TRKA; structur 98.06
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.01
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.01
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 98.01
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 97.99
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.98
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 97.94
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.9
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 97.89
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.87
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 97.87
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.86
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.86
3qha_A296 Putative oxidoreductase; seattle structural genomi 97.86
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 97.86
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 97.84
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 97.83
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 97.82
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 97.81
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 97.8
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.79
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 97.79
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 97.79
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 97.79
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.79
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 97.77
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 97.75
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.71
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 97.71
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.68
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 97.68
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.68
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 97.66
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 97.66
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 97.65
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 97.65
4ezb_A317 Uncharacterized conserved protein; structural geno 97.64
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 97.62
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 97.61
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.61
1r0k_A388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 97.6
3l6d_A306 Putative oxidoreductase; structural genomics, prot 97.58
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.58
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 97.57
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.56
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 97.56
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 97.55
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 97.55
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 97.55
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.52
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 97.51
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.51
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.5
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 97.5
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 97.49
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 97.49
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 97.49
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 97.49
1vpd_A299 Tartronate semialdehyde reductase; structural geno 97.48
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.48
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.48
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.47
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 97.45
3euw_A344 MYO-inositol dehydrogenase; protein structure init 97.44
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 97.43
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 97.43
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.43
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.43
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 97.42
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 97.42
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.41
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.41
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.41
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 97.39
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 97.39
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.38
4eye_A342 Probable oxidoreductase; structural genomics, niai 97.38
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 97.38
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 97.37
4g65_A461 TRK system potassium uptake protein TRKA; structur 97.35
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 97.35
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 97.35
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 97.35
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 97.35
3gms_A340 Putative NADPH:quinone reductase; structural genom 97.34
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 97.34
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.34
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.32
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 97.32
1yb4_A295 Tartronic semialdehyde reductase; structural genom 97.32
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 97.32
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 97.31
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.3
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 97.3
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 97.29
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 97.29
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.28
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 97.27
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 97.27
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.26
2duw_A145 Putative COA-binding protein; ligand binding prote 97.25
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.25
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 97.24
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 97.23
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.22
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 97.22
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.22
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 97.21
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 97.21
2d59_A144 Hypothetical protein PH1109; COA binding, structur 97.21
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 97.21
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 97.21
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 97.21
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 97.2
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 97.19
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.19
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 97.18
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 97.16
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.16
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 97.15
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 97.15
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 97.15
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 97.15
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 97.15
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 97.15
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.14
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 97.14
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 97.14
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 97.12
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 97.12
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 97.09
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.08
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.08
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 97.08
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.08
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 97.08
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 97.07
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 97.06
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 97.06
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 97.06
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 97.05
1iuk_A140 Hypothetical protein TT1466; structural genomics, 97.05
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 97.04
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.04
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 97.04
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 97.03
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.03
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.02
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 97.02
3fbg_A346 Putative arginate lyase; structural genomics, unkn 97.02
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.02
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.02
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 97.01
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 97.01
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
Probab=100.00  E-value=6.9e-47  Score=328.70  Aligned_cols=303  Identities=39%  Similarity=0.713  Sum_probs=260.1

Q ss_pred             CceEEEEccCcchhHHHHHHHHhCCCCEEEEEcCCCCCCCchhhHhHhhhcCCcEEEEccCCCHHHHHHHhc--CCCEEE
Q 021596            4 KSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFVVGDVLNHESLVNAIK--QVDVVI   81 (310)
Q Consensus         4 ~~~IlI~GatG~iG~~l~~~L~~~g~~V~~~~R~~~~~~~~~~~~~~~l~~~~~~~v~~D~~d~~~~~~~~~--~~d~Vi   81 (310)
                      +|+|+||||||+||+++++.|+++|++|++++|+.+.. +.+...+..+...+++++.+|+.|.+++.++++  ++|+||
T Consensus        10 ~~~IlVtGatG~iG~~l~~~L~~~g~~V~~l~R~~~~~-~~~~~~~~~l~~~~v~~~~~Dl~d~~~l~~~~~~~~~d~Vi   88 (346)
T 3i6i_A           10 KGRVLIAGATGFIGQFVATASLDAHRPTYILARPGPRS-PSKAKIFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVV   88 (346)
T ss_dssp             -CCEEEECTTSHHHHHHHHHHHHTTCCEEEEECSSCCC-HHHHHHHHHHHHTTCEEEECCTTCHHHHHHHHHHTTCCEEE
T ss_pred             CCeEEEECCCcHHHHHHHHHHHHCCCCEEEEECCCCCC-hhHHHHHHHHHhCCcEEEEeecCCHHHHHHHHhhCCCCEEE
Confidence            46899999999999999999999999999999986433 456555566777899999999999999999999  999999


Q ss_pred             EcccchhhhhHHHHHHHHHHcCCccEEccCCCCCCccccCCCCCCcchhhHHHHHHHHHHHHHcCCCEEEEecceecccc
Q 021596           82 STVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYF  161 (310)
Q Consensus        82 ~~a~~~~~~~~~~~~~aa~~~~~v~~~v~s~~~~~~~~~~~~~~~~~~~y~~~K~~~e~~l~~~~~~~~i~rp~~~~~~~  161 (310)
                      |+++...+.++.+++++|++.+++++||+|+||...++.+ +.. +...|+.+|+.+|+++++.+++++++||+.|++++
T Consensus        89 ~~a~~~n~~~~~~l~~aa~~~g~v~~~v~S~~g~~~~e~~-~~~-p~~~y~~sK~~~e~~l~~~g~~~tivrpg~~~g~~  166 (346)
T 3i6i_A           89 STVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRAD-PVE-PGLNMYREKRRVRQLVEESGIPFTYICCNSIASWP  166 (346)
T ss_dssp             ECCCGGGGGGHHHHHHHHHHHCCCSEEECSCCSSCTTTCC-CCT-THHHHHHHHHHHHHHHHHTTCCBEEEECCEESSCC
T ss_pred             ECCchhhHHHHHHHHHHHHHcCCceEEeecccCCCCCccC-cCC-CcchHHHHHHHHHHHHHHcCCCEEEEEeccccccc
Confidence            9999888889999999999997789999999987655443 433 36789899999999999999999999999999988


Q ss_pred             ccccCCCCCCCCCCCeEEEecCCCceeEeeccchHHHHHHHHhcCCccCCceEEEcCCCCccCHHHHHHHHHHHhCCCce
Q 021596          162 LPNLLQPGAAAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTLE  241 (310)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~D~a~~~~~~l~~~~~~~~~~~~~~~~~~~s~~e~~~~~~~~~g~~~~  241 (310)
                      .+.+..........+.+.++++++..++|++++|+|++++.++.++...++.+++.++++.+|+.|+++.+++.+|++.+
T Consensus       167 ~~~~~~~~~~~~~~~~~~~~g~g~~~~~~i~~~Dva~~~~~~l~~~~~~~~~~~i~g~~~~~s~~e~~~~~~~~~g~~~~  246 (346)
T 3i6i_A          167 YYNNIHPSEVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKSVHFRPSCNCLNINELASVWEKKIGRTLP  246 (346)
T ss_dssp             CSCC-----CCCCSSCEEEETTSCCCEEEECHHHHHHHHHHHTTCGGGTTEEEECCCGGGEECHHHHHHHHHHHHTSCCC
T ss_pred             CccccccccccCCCceEEEccCCCceEEecCHHHHHHHHHHHHhCccccCeEEEEeCCCCCCCHHHHHHHHHHHHCCCCc
Confidence            76655543233456678889999999999999999999999999987778999998777799999999999999999999


Q ss_pred             eeecCHHHHHHHHHhcCCCcchhHHhhhheeEecccccccCC-CCccccccccCCCCcccCHHHHHHhhC
Q 021596          242 REYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIE-PSFGVEASQLFPDVKYTTVDEYLNQFV  310 (310)
Q Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~-~~~~~~~~~~~p~~~~~~~~e~l~~~~  310 (310)
                      +..+|.+++.+.+...++|....+..++.++..|...+|+.+ .. +.+..+++|++++|+++|||++++
T Consensus       247 ~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~g~~~~~~~~~~~-~~~~~~~~p~~~~t~~~e~l~~~~  315 (346)
T 3i6i_A          247 RVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPE-DVEVTTLYPEDSFRTVEECFGEYI  315 (346)
T ss_dssp             EEEECHHHHHHHHHTCCTTHHHHHHHHHHHHTTCTTTSSCCCSTT-EEEHHHHSTTCCCCCHHHHHHHHH
T ss_pred             eEecCHHHHHHHHhcCCChhhhHHHHHHHHhccCCCcccccCCCC-cccHHHhCCCCCcCcHHHHHHHHH
Confidence            999999999999988888888888888888888877667774 22 356789999999999999999863



>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 310
d1qyca_307 c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta 4e-65
d1qyda_312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 2e-63
d1xgka_350 c.2.1.2 (A:) Negative transcriptional regulator Nm 1e-23
d1hdoa_205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 2e-14
d2q46a1252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 2e-08
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 4e-08
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 5e-08
d1udca_338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 7e-08
d1orra_338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 8e-08
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 1e-07
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 2e-07
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 2e-07
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 2e-07
d2blla1342 c.2.1.2 (A:316-657) Polymyxin resistance protein A 1e-06
d1z45a2347 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep 2e-06
d1i24a_393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 3e-06
d2c5aa1363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 3e-06
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 6e-06
d1rkxa_356 c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia 7e-06
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 8e-06
d1n7ha_339 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr 9e-06
d1n2sa_298 c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reduct 1e-05
d1ek6a_346 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 1e-05
d2a35a1212 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pse 5e-05
d1sb8a_341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 2e-04
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 0.001
d2bkaa1232 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H 0.002
d1vl0a_281 c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD 0.003
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 0.003
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Phenylcoumaran benzylic ether reductase
species: Loblolly pine (Pinus taeda) [TaxId: 3352]
 Score =  205 bits (520), Expect = 4e-65
 Identities = 191/309 (61%), Positives = 231/309 (74%), Gaps = 4/309 (1%)

Query: 3   SKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVREST-LSAPSKSQLLDHFKNLGVNFVV 61
           S+S+IL IG TGYIG+ + +AS+  GHPTF+LVREST  S   K+QLL+ FK  G N V 
Sbjct: 2   SRSRILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASGANIVH 61

Query: 62  GDVLNHESLVNAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAH 121
           G + +H SLV A+K VDVVISTVG   +  QV II AIKE G V RFFPSEFGNDVD  H
Sbjct: 62  GSIDDHASLVEAVKNVDVVISTVGSLQIESQVNIIKAIKEVGTVKRFFPSEFGNDVDNVH 121

Query: 122 GAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPGAAAPPRDKVVIL 181
                     ++VKA++RRA+EAEGIPYTYV S CF GYFL +L Q G  APPRDKVVIL
Sbjct: 122 --AVEPAKSVFEVKAKVRRAIEAEGIPYTYVSSNCFAGYFLRSLAQAGLTAPPRDKVVIL 179

Query: 182 GDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIGKTLE 241
           GDGN + V+ KE+DI T+TIKAVDDPRTLNK LY++ P N  S N+LV+LWE+KI KTLE
Sbjct: 180 GDGNARVVFVKEEDIGTFTIKAVDDPRTLNKTLYLRLPANTLSLNELVALWEKKIDKTLE 239

Query: 242 REYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTT 301
           + YV EE++LK I +   P N+ ++I HS+F+ G QTNFEI P+ GVEASQL+PDVKYTT
Sbjct: 240 KAYVPEEEVLKLIADTPFPANISIAISHSIFVKGDQTNFEIGPA-GVEASQLYPDVKYTT 298

Query: 302 VDEYLNQFV 310
           VDEYL+ FV
Sbjct: 299 VDEYLSNFV 307


>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Length = 342 Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Length = 298 Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Length = 212 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Length = 281 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 100.0
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 100.0
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 100.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 100.0
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 100.0
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 100.0
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.97
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.97
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.97
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.97
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.97
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.97
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.97
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.97
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 99.97
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.96
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.96
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.96
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.96
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.96
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.96
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.95
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.95
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.94
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.94
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.93
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.9
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.87
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.87
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.75
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.72
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.72
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.7
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.7
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.7
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.7
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.69
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.69
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.68
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.68
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.68
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.68
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.67
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.67
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.67
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.66
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.66
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.66
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.66
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.66
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.65
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.64
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.64
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.63
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.63
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.63
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.63
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.63
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.63
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.62
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.62
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.61
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.61
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.6
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.6
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.6
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.59
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.59
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.59
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.59
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.58
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.58
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.57
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.57
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.56
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.54
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.53
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.53
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.51
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.51
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.51
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.45
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.42
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.41
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.41
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.37
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.37
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.34
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.33
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.31
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.29
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.25
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.18
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.16
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 98.96
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.91
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.69
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 98.62
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 98.53
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.47
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 98.27
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.21
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.15
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.08
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 98.06
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 98.04
d1id1a_153 Rck domain from putative potassium channel Kch {Es 98.01
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 98.01
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 98.01
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 98.0
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.99
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.99
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.95
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.95
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.94
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.94
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.94
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 97.84
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.82
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 97.82
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.82
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 97.81
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.79
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.78
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.75
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.74
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.73
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.73
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.71
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.67
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 97.65
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 97.64
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 97.63
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.62
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.61
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.61
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 97.61
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.61
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.6
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 97.6
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.56
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 97.55
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 97.55
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 97.54
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 97.52
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 97.52
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 97.5
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.49
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.46
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.43
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 97.42
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.41
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 97.39
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 97.37
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.37
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 97.36
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.36
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.35
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.34
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.32
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 97.31
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.31
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.3
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 97.29
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 97.29
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.25
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.24
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.22
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.21
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 97.18
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.17
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 97.15
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 97.11
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 97.09
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.04
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 97.01
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 97.0
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.98
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.94
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.9
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 96.9
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 96.9
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.9
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 96.9
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.83
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.82
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 96.78
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.75
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.69
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.62
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.59
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 96.59
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.55
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.54
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.54
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 96.52
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.51
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.49
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 96.41
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.37
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.35
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.32
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.31
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 96.3
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.3
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.28
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.27
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.26
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.07
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.06
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.99
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.93
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.93
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 95.92
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 95.91
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.85
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.76
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 95.67
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 95.65
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.62
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.62
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.62
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.59
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 95.49
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.47
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 95.45
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.44
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 95.38
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.27
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.27
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 95.22
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 95.19
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.17
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.15
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.04
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 95.01
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.0
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.93
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 94.89
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.79
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 94.76
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 94.72
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 94.71
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 94.67
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 94.66
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.61
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.56
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 94.47
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 94.41
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.35
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.32
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 94.28
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 94.27
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.11
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 94.04
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 93.99
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 93.93
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 93.89
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 93.89
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.79
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 93.78
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 93.72
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 93.6
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 93.59
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 93.53
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 93.51
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 93.41
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 93.39
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 93.33
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.28
d1qkia1203 Glucose 6-phosphate dehydrogenase, N-terminal doma 93.09
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 93.03
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 92.9
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 92.86
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 92.85
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 92.55
d1h9aa1195 Glucose 6-phosphate dehydrogenase, N-terminal doma 92.51
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 92.5
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 92.38
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 92.27
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 92.23
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 92.04
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 91.83
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 91.72
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 91.62
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 91.53
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 91.5
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 91.36
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 91.28
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 90.8
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 90.58
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 90.51
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 90.41
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.38
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 90.38
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 90.25
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 90.22
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 90.05
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 89.93
d1p9oa_290 Phosphopantothenoylcysteine synthetase {Human (Hom 89.84
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.71
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 89.67
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 89.44
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.39
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 89.35
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 88.82
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 88.46
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 88.29
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 88.09
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 88.02
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 87.64
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 87.02
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 86.96
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 86.73
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.56
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 86.43
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.37
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 86.3
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 86.29
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 86.25
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 86.19
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 86.16
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 86.05
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 85.96
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 85.35
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 85.34
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 85.25
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 84.04
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 83.29
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 83.14
d2ax3a2211 Hypothetical protein TM0922, N-terminal domain {Th 82.95
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 82.76
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 82.39
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 82.38
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 82.34
d1t0ia_185 Hypothetical protein Ylr011wp {Baker's yeast (Sacc 82.25
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.75
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 81.73
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 81.49
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 81.34
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 80.85
d1jzta_243 Hypothetical protein YNL200c (YNU0_YEAST) {Baker's 80.53
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Pinoresinol-lariciresinol reductase
species: Giant arborvitae (Thuja plicata) [TaxId: 3316]
Probab=100.00  E-value=6e-42  Score=291.06  Aligned_cols=306  Identities=46%  Similarity=0.819  Sum_probs=249.0

Q ss_pred             CCceEEEEccCcchhHHHHHHHHhCCCCEEEEEcCCCCCCCchhhHhHhhhcCCcEEEEccCCCHHHHHHHhcCCCEEEE
Q 021596            3 SKSKILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTLSAPSKSQLLDHFKNLGVNFVVGDVLNHESLVNAIKQVDVVIS   82 (310)
Q Consensus         3 ~~~~IlI~GatG~iG~~l~~~L~~~g~~V~~~~R~~~~~~~~~~~~~~~l~~~~~~~v~~D~~d~~~~~~~~~~~d~Vi~   82 (310)
                      +++||||||||||||+++++.|+++||+|++++|+.......+......+...+++++++|+.|.+++.+++++++++++
T Consensus         2 ~k~KILVtGatG~iG~~l~~~L~~~G~~V~~~~R~~~~~~~~~~~~~~~~~~~~v~~v~~d~~d~~~~~~~~~~~~~~~~   81 (312)
T d1qyda_           2 KKSRVLIVGGTGYIGKRIVNASISLGHPTYVLFRPEVVSNIDKVQMLLYFKQLGAKLIEASLDDHQRLVDALKQVDVVIS   81 (312)
T ss_dssp             CCCCEEEESTTSTTHHHHHHHHHHTTCCEEEECCSCCSSCHHHHHHHHHHHTTTCEEECCCSSCHHHHHHHHTTCSEEEE
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHhCCCEEEEEECCCcccchhHHHHHhhhccCCcEEEEeecccchhhhhhccCcchhhh
Confidence            36789999999999999999999999999999998766545555666667778999999999999999999999999999


Q ss_pred             cccchh----hhhHHHHHHHHHHcCCccEEccCCCCCCccccCCCCCCcchhhHHHHHHHHHHHHHcCCCEEEEecceec
Q 021596           83 TVGHAL----LADQVKIIAAIKEAGNVTRFFPSEFGNDVDRAHGAVEPAKSVYYDVKARIRRAVEAEGIPYTYVESYCFD  158 (310)
Q Consensus        83 ~a~~~~----~~~~~~~~~aa~~~~~v~~~v~s~~~~~~~~~~~~~~~~~~~y~~~K~~~e~~l~~~~~~~~i~rp~~~~  158 (310)
                      +++...    ...+.+++++|++.+..+++++|+++........+..+ ...|...|..++++.+..+++++++||+.++
T Consensus        82 ~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~Ss~g~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~i~r~~~~~  160 (312)
T d1qyda_          82 ALAGGVLSHHILEQLKLVEAIKEAGNIKRFLPSEFGMDPDIMEHALQP-GSITFIDKRKVRRAIEAASIPYTYVSSNMFA  160 (312)
T ss_dssp             CCCCSSSSTTTTTHHHHHHHHHHSCCCSEEECSCCSSCTTSCCCCCSS-TTHHHHHHHHHHHHHHHTTCCBCEEECCEEH
T ss_pred             hhhhcccccchhhhhHHHHHHHHhcCCcEEEEeeccccCCCcccccch-hhhhhHHHHHHHHhhcccccceEEeccceee
Confidence            987654    66788899999988756777889888765544313333 5566699999999999999999999999999


Q ss_pred             cccccccCCCCC-CCCCCCeEEEecCCCceeEeeccchHHHHHHHHhcCCccCCceEEEcCCCCccCHHHHHHHHHHHhC
Q 021596          159 GYFLPNLLQPGA-AAPPRDKVVILGDGNPKAVYNKEDDIATYTIKAVDDPRTLNKNLYIQPPGNIYSFNDLVSLWERKIG  237 (310)
Q Consensus       159 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~i~~~D~a~~~~~~l~~~~~~~~~~~~~~~~~~~s~~e~~~~~~~~~g  237 (310)
                      ++..+.+..... .....+...++++++..++|++++|+|++++.++.+++..++.+++.++++.+|+.|+++.+++.+|
T Consensus       161 g~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~i~v~Dva~a~~~~l~~~~~~~~~~~~~~~~~~~s~~e~~~~~~~~~g  240 (312)
T d1qyda_         161 GYFAGSLAQLDGHMMPPRDKVLIYGDGNVKGIWVDEDDVGTYTIKSIDDPQTLNKTMYIRPPMNILSQKEVIQIWERLSE  240 (312)
T ss_dssp             HHHTTTSSCTTCCSSCCSSEECCBTTSCSEEEEECHHHHHHHHHHHTTCGGGSSSEEECCCGGGEEEHHHHHHHHHHHHT
T ss_pred             cCCccchhhHHHHhhhcccccccccccccccceeeHHHHHHHHHHHhcCccccCceEEEeCCCcCCCHHHHHHHHHHHHC
Confidence            876544433222 1235667788899999999999999999999999998888888888777778999999999999999


Q ss_pred             CCceeeecCHHHHHHHHHhcCCCcchhHHhhhheeEecccccccCCCCccccccccCCCCcccCHHHHHHhhC
Q 021596          238 KTLEREYVSEEQLLKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV  310 (310)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~p~~~~~~~~e~l~~~~  310 (310)
                      ++.++..+|.+++...+...++|........+..+..|...++..... ..+..+++|++++||++|||+++|
T Consensus       241 ~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~ea~~l~Pd~~~tt~~e~l~~~v  312 (312)
T d1qyda_         241 QNLDKIYISSQDFLADMKDKSYEEKIVRCHLYQIFFRGDLYNFEIGPN-AIEATKLYPEVKYVTMDSYLERYV  312 (312)
T ss_dssp             CCCEECCBCSHHHHHHHTTSCTTHHHHTTTHHHHTTSCTTTSSCCCSS-EEEHHHHCTTSCCCCHHHHHTTTC
T ss_pred             CCCeEEECCHHHHHHHHHhcCCcHhHHHHHHHHHHhcCcccccccCcc-hhhHHHhCCCCCcCcHHHHHHhhC
Confidence            999999999998888887778887766555555555555444444332 245567899999999999999986



>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1qkia1 c.2.1.3 (A:12-199,A:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h9aa1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ax3a2 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jzta_ c.104.1.1 (A:) Hypothetical protein YNL200c (YNU0_YEAST) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure