Citrus Sinensis ID: 021599
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 310 | ||||||
| 359486310 | 304 | PREDICTED: uncharacterized protein LOC10 | 0.954 | 0.973 | 0.801 | 1e-108 | |
| 356572371 | 297 | PREDICTED: uncharacterized protein LOC10 | 0.909 | 0.949 | 0.673 | 4e-93 | |
| 225439817 | 307 | PREDICTED: uncharacterized protein LOC10 | 0.967 | 0.977 | 0.730 | 1e-92 | |
| 147774947 | 306 | hypothetical protein VITISV_036556 [Viti | 0.967 | 0.980 | 0.662 | 1e-92 | |
| 297736448 | 278 | unnamed protein product [Vitis vinifera] | 0.770 | 0.859 | 0.836 | 3e-91 | |
| 449451689 | 309 | PREDICTED: serine/arginine-rich splicing | 0.964 | 0.967 | 0.762 | 6e-91 | |
| 255568494 | 305 | arginine/serine-rich splicing factor, pu | 0.893 | 0.908 | 0.695 | 1e-89 | |
| 363807264 | 299 | uncharacterized protein LOC100813237 [Gl | 0.912 | 0.946 | 0.655 | 1e-88 | |
| 388495254 | 300 | unknown [Lotus japonicus] | 0.890 | 0.92 | 0.658 | 4e-83 | |
| 356572373 | 287 | PREDICTED: uncharacterized protein LOC10 | 0.903 | 0.975 | 0.669 | 4e-82 |
| >gi|359486310|ref|XP_002281756.2| PREDICTED: uncharacterized protein LOC100251921 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 396 bits (1018), Expect = e-108, Method: Compositional matrix adjust.
Identities = 246/307 (80%), Positives = 264/307 (85%), Gaps = 11/307 (3%)
Query: 1 MPRYDDRYGGTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADDA 60
MPRYDDR+G TRLYVGRL+SRTRSRDLE++FSRYGR+RDVDMK DFAFVEFSDPRDADDA
Sbjct: 1 MPRYDDRHGSTRLYVGRLSSRTRSRDLEDLFSRYGRVRDVDMKHDFAFVEFSDPRDADDA 60
Query: 61 RYSLNGRDVDGSRIIVEFARGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKAG 120
RYSLNGRD DGSRIIVEFA+GGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKAG
Sbjct: 61 RYSLNGRDFDGSRIIVEFAKGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKAG 120
Query: 121 DWKNKCYRCGERGHIERNCQNSPKKLRRPRSY----SRSPSPRRGRSRSRSYSRGRSDSR 176
DWKNKCYRCGERGHIERNCQNSPKKL+R RSY S R RSRSRSYSR RS S+
Sbjct: 121 DWKNKCYRCGERGHIERNCQNSPKKLKRGRSYSRSPSPRRGRSRSRSRSRSYSRSRSYSQ 180
Query: 177 SRSPVKRDRSVERFERRTRSPRDSRSPKRRRNSPPSSKGRKRSPTPDERSPQDQRSPSPR 236
RS KR+RS ER ERR+RSP DSRSPKRR+ SPP SKGRKRSPTPDERSP+ +RSPSPR
Sbjct: 181 PRSSPKRERSAERLERRSRSPHDSRSPKRRKASPPPSKGRKRSPTPDERSPK-ERSPSPR 239
Query: 237 DRRQ-ANGSEYSGSPRGKSRSPVDDA--DGPEDRNY-RSPPEENGRSRSRSLSPVPRDDR 292
DR+Q NGS+YS SPR KSRSP DA D P DRNY RSP EENG SRS SP+PRDD
Sbjct: 240 DRKQTTNGSDYSDSPRVKSRSPALDAERDSPRDRNYRRSPDEENG--HSRSPSPIPRDDA 297
Query: 293 SPIDDDD 299
SP+DDD+
Sbjct: 298 SPVDDDE 304
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356572371|ref|XP_003554342.1| PREDICTED: uncharacterized protein LOC100789337 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225439817|ref|XP_002277105.1| PREDICTED: uncharacterized protein LOC100258584 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147774947|emb|CAN60012.1| hypothetical protein VITISV_036556 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297736448|emb|CBI25319.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449451689|ref|XP_004143594.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 1 [Cucumis sativus] gi|449451691|ref|XP_004143595.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 2 [Cucumis sativus] gi|449507559|ref|XP_004163066.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 1 [Cucumis sativus] gi|449507562|ref|XP_004163067.1| PREDICTED: serine/arginine-rich splicing factor RS2Z32-like isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255568494|ref|XP_002525221.1| arginine/serine-rich splicing factor, putative [Ricinus communis] gi|223535518|gb|EEF37187.1| arginine/serine-rich splicing factor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|363807264|ref|NP_001242616.1| uncharacterized protein LOC100813237 [Glycine max] gi|255647309|gb|ACU24121.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388495254|gb|AFK35693.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356572373|ref|XP_003554343.1| PREDICTED: uncharacterized protein LOC100789862 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 310 | ||||||
| TAIR|locus:2049766 | 290 | RS2Z33 "arginine/serine-rich z | 0.461 | 0.493 | 0.787 | 5.3e-69 | |
| TAIR|locus:2083936 | 284 | RS2Z32 "arginine/serine-rich z | 0.451 | 0.492 | 0.797 | 1.4e-68 | |
| UNIPROTKB|C9JAB2 | 235 | SRSF7 "Serine/arginine-rich-sp | 0.422 | 0.557 | 0.405 | 3.7e-22 | |
| UNIPROTKB|D4A720 | 238 | Sfrs7 "Protein Sfrs7" [Rattus | 0.422 | 0.550 | 0.405 | 3.7e-22 | |
| UNIPROTKB|Q3T106 | 235 | SRSF7 "Serine/arginine-rich sp | 0.422 | 0.557 | 0.405 | 6e-22 | |
| UNIPROTKB|Q16629 | 238 | SRSF7 "Serine/arginine-rich sp | 0.422 | 0.550 | 0.405 | 6e-22 | |
| UNIPROTKB|J9P2I8 | 238 | SRSF7 "Uncharacterized protein | 0.422 | 0.550 | 0.405 | 6e-22 | |
| WB|WBGene00004698 | 312 | rsp-1 [Caenorhabditis elegans | 0.219 | 0.217 | 0.5 | 1.1e-21 | |
| UNIPROTKB|Q23121 | 312 | rsp-1 "Probable splicing facto | 0.219 | 0.217 | 0.5 | 1.1e-21 | |
| ZFIN|ZDB-GENE-030131-7336 | 259 | srsf5a "serine/arginine-rich s | 0.319 | 0.382 | 0.423 | 6.6e-21 |
| TAIR|locus:2049766 RS2Z33 "arginine/serine-rich zinc knuckle-containing protein 33" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 651 (234.2 bits), Expect = 5.3e-69, Sum P(2) = 5.3e-69
Identities = 115/146 (78%), Positives = 128/146 (87%)
Query: 1 MPRYDDRYGGTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADDA 60
MPRYDDRYG TRLYVGRL+SRTR+RDLE +FSRYGR+RDVDMKRD+AFVEF DPRDADDA
Sbjct: 1 MPRYDDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFGDPRDADDA 60
Query: 61 RYSLNGRDVDGSRIIVEFAXXXXXXXXXSREYLGRGPPPGSGRCFNCGIDGHWARDCKAG 120
R+ L+GRD DGSRI VEF+ SR++ RGPPPG+GRCFNCG+DGHWARDC AG
Sbjct: 61 RHYLDGRDFDGSRITVEFSRGAPRG---SRDFDSRGPPPGAGRCFNCGVDGHWARDCTAG 117
Query: 121 DWKNKCYRCGERGHIERNCQNSPKKL 146
DWKNKCYRCGERGHIERNC+NSPKKL
Sbjct: 118 DWKNKCYRCGERGHIERNCKNSPKKL 143
|
|
| TAIR|locus:2083936 RS2Z32 "arginine/serine-rich zinc knuckle-containing protein 32" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JAB2 SRSF7 "Serine/arginine-rich-splicing factor 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A720 Sfrs7 "Protein Sfrs7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T106 SRSF7 "Serine/arginine-rich splicing factor 7" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q16629 SRSF7 "Serine/arginine-rich splicing factor 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P2I8 SRSF7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00004698 rsp-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q23121 rsp-1 "Probable splicing factor, arginine/serine-rich 1" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-7336 srsf5a "serine/arginine-rich splicing factor 5a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00029498001 | SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (288 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00000599001 | • | • | 0.443 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 310 | |||
| cd12337 | 70 | cd12337, RRM1_SRSF4_like, RNA recognition motif 1 | 3e-24 | |
| cd12596 | 70 | cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve | 5e-20 | |
| cd12373 | 73 | cd12373, RRM_SRSF3_like, RNA recognition motif in | 3e-19 | |
| cd12382 | 80 | cd12382, RRM_RBMX_like, RNA recognition motif in h | 4e-19 | |
| smart00360 | 73 | smart00360, RRM, RNA recognition motif | 7e-19 | |
| cd00590 | 72 | cd00590, RRM_SF, RNA recognition motif (RRM) super | 3e-18 | |
| cd12594 | 74 | cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve | 2e-17 | |
| pfam00076 | 70 | pfam00076, RRM_1, RNA recognition motif | 6e-17 | |
| cd12595 | 70 | cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve | 6e-17 | |
| cd12338 | 72 | cd12338, RRM1_SRSF1_like, RNA recognition motif 1 | 2e-16 | |
| cd12233 | 70 | cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m | 2e-16 | |
| cd12343 | 66 | cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 | 3e-15 | |
| cd12341 | 68 | cd12341, RRM_hnRNPC_like, RNA recognition motif in | 7e-15 | |
| cd12598 | 72 | cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve | 8e-15 | |
| cd12365 | 73 | cd12365, RRM_RNPS1, RNA recognition motif in RNA-b | 4e-14 | |
| cd12597 | 73 | cd12597, RRM1_SRSF1, RNA recognition motif 1 in se | 4e-14 | |
| cd12599 | 72 | cd12599, RRM1_SF2_plant_like, RNA recognition moti | 7e-13 | |
| pfam14259 | 69 | pfam14259, RRM_6, RNA recognition motif (a | 1e-12 | |
| pfam13893 | 56 | pfam13893, RRM_5, RNA recognition motif | 1e-12 | |
| cd12399 | 78 | cd12399, RRM_HP0827_like, RNA recognition motif in | 2e-12 | |
| cd12609 | 68 | cd12609, RRM2_CoAA, RNA recognition motif 2 in ver | 4e-12 | |
| cd12608 | 69 | cd12608, RRM1_CoAA, RNA recognition motif 1 in ver | 9e-12 | |
| cd12312 | 84 | cd12312, RRM_SRSF10_SRSF12, RNA recognition motif | 1e-11 | |
| cd12235 | 83 | cd12235, RRM_PPIL4, RNA recognition motif in pepti | 2e-11 | |
| cd12449 | 80 | cd12449, RRM_CIRBP_RBM3, RNA recognition motif in | 2e-11 | |
| cd12355 | 80 | cd12355, RRM_RBM18, RNA recognition motif in eukar | 2e-11 | |
| cd12646 | 77 | cd12646, RRM_SRSF7, RNA recognition motif in verte | 3e-11 | |
| cd12273 | 71 | cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve | 4e-11 | |
| cd12251 | 72 | cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 | 4e-11 | |
| cd12237 | 93 | cd12237, RRM_snRNP35, RNA recognition motif found | 9e-11 | |
| cd12322 | 71 | cd12322, RRM2_TDP43, RNA recognition motif 2 in TA | 3e-10 | |
| cd12407 | 76 | cd12407, RRM_FOX1_like, RNA recognition motif in v | 6e-10 | |
| cd12311 | 73 | cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in | 1e-09 | |
| cd12363 | 78 | cd12363, RRM_TRA2, RNA recognition motif in transf | 1e-09 | |
| cd12414 | 76 | cd12414, RRM2_RBM28_like, RNA recognition motif 2 | 2e-09 | |
| cd12340 | 67 | cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in | 4e-09 | |
| cd12390 | 92 | cd12390, RRM3_RAVER, RNA recognition motif 3 in ri | 4e-09 | |
| cd12240 | 78 | cd12240, RRM_NCBP2, RNA recognition motif found in | 4e-09 | |
| cd12236 | 91 | cd12236, RRM_snRNP70, RNA recognition motif in U1 | 5e-09 | |
| cd12352 | 72 | cd12352, RRM1_TIA1_like, RNA recognition motif 1 i | 5e-09 | |
| cd12495 | 72 | cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v | 5e-09 | |
| cd12354 | 73 | cd12354, RRM3_TIA1_like, RNA recognition motif 2 i | 6e-09 | |
| cd12347 | 73 | cd12347, RRM_PPIE, RNA recognition motif in cyclop | 6e-09 | |
| cd12606 | 67 | cd12606, RRM1_RBM4, RNA recognition motif 1 in ver | 6e-09 | |
| cd12614 | 74 | cd12614, RRM1_PUB1, RNA recognition motif 1 in yea | 7e-09 | |
| cd12645 | 81 | cd12645, RRM_SRSF3, RNA recognition motif in verte | 9e-09 | |
| cd12283 | 73 | cd12283, RRM1_RBM39_like, RNA recognition motif 1 | 1e-08 | |
| cd12560 | 84 | cd12560, RRM_SRSF12, RNA recognition motif in seri | 1e-08 | |
| cd12375 | 77 | cd12375, RRM1_Hu_like, RNA recognition motif 1 in | 2e-08 | |
| PTZ00368 | 148 | PTZ00368, PTZ00368, universal minicircle sequence | 3e-08 | |
| cd12226 | 78 | cd12226, RRM_NOL8, RNA recognition motif in nucleo | 3e-08 | |
| cd12413 | 79 | cd12413, RRM1_RBM28_like, RNA recognition motif 1 | 3e-08 | |
| cd12284 | 73 | cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 | 4e-08 | |
| cd12320 | 76 | cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot | 4e-08 | |
| cd12234 | 72 | cd12234, RRM1_AtRSp31_like, RNA recognition motif | 5e-08 | |
| cd12603 | 71 | cd12603, RRM_hnRNPC, RNA recognition motif in vert | 8e-08 | |
| cd12527 | 71 | cd12527, RRM2_EAR1_like, RNA recognition motif 2 i | 1e-07 | |
| cd12342 | 71 | cd12342, RRM_Nab3p, RNA recognition motif in yeast | 1e-07 | |
| cd12276 | 71 | cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti | 1e-07 | |
| cd12564 | 76 | cd12564, RRM1_RBM19, RNA recognition motif 1 in RN | 1e-07 | |
| cd12529 | 71 | cd12529, RRM2_MEI2_like, RNA recognition motif 2 i | 1e-07 | |
| cd12570 | 76 | cd12570, RRM5_MRD1, RNA recognition motif 5 in yea | 2e-07 | |
| cd12494 | 72 | cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v | 2e-07 | |
| cd12637 | 80 | cd12637, RRM2_FCA, RNA recognition motif 2 in plan | 2e-07 | |
| cd12559 | 84 | cd12559, RRM_SRSF10, RNA recognition motif in seri | 2e-07 | |
| cd12380 | 80 | cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou | 2e-07 | |
| cd12310 | 72 | cd12310, RRM3_Spen, RNA recognition motif 3 in the | 4e-07 | |
| cd12315 | 77 | cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 | 4e-07 | |
| cd12316 | 74 | cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot | 4e-07 | |
| cd12466 | 70 | cd12466, RRM2_AtRSp31_like, RNA recognition motif | 4e-07 | |
| cd12325 | 72 | cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition | 5e-07 | |
| cd12498 | 83 | cd12498, RRM3_ACF, RNA recognition motif 3 in vert | 5e-07 | |
| cd12350 | 74 | cd12350, RRM3_SHARP, RNA recognition motif 3 in SM | 5e-07 | |
| cd12417 | 74 | cd12417, RRM_SAFB_like, RNA recognition motif in t | 9e-07 | |
| cd12497 | 74 | cd12497, RRM3_RBM47, RNA recognition motif 3 in ve | 9e-07 | |
| cd12607 | 67 | cd12607, RRM2_RBM4, RNA recognition motif 2 in ver | 1e-06 | |
| cd12604 | 76 | cd12604, RRM_RALY, RNA recognition motif in verteb | 1e-06 | |
| cd12328 | 73 | cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 | 1e-06 | |
| PTZ00368 | 148 | PTZ00368, PTZ00368, universal minicircle sequence | 2e-06 | |
| cd12565 | 76 | cd12565, RRM1_MRD1, RNA recognition motif 1 in yea | 2e-06 | |
| cd12675 | 83 | cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye | 2e-06 | |
| cd12566 | 79 | cd12566, RRM2_MRD1, RNA recognition motif 2 in yea | 2e-06 | |
| cd12422 | 85 | cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m | 2e-06 | |
| cd12369 | 68 | cd12369, RRM4_RBM45, RNA recognition motif 4 in RN | 2e-06 | |
| cd12298 | 78 | cd12298, RRM3_Prp24, RNA recognition motif 3 in fu | 3e-06 | |
| cd12641 | 89 | cd12641, RRM_TRA2B, RNA recognition motif in Trans | 4e-06 | |
| cd12467 | 78 | cd12467, RRM_Srp1p_like, RNA recognition motif 1 i | 4e-06 | |
| COG5082 | 190 | COG5082, AIR1, Arginine methyltransferase-interact | 4e-06 | |
| cd12246 | 78 | cd12246, RRM1_U1A_like, RNA recognition motif 1 in | 4e-06 | |
| cd12418 | 75 | cd12418, RRM_Aly_REF_like, RNA recognition motif i | 4e-06 | |
| cd12313 | 84 | cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti | 4e-06 | |
| cd12454 | 80 | cd12454, RRM2_RIM4_like, RNA recognition motif 2 i | 5e-06 | |
| cd12278 | 84 | cd12278, RRM_eIF3B, RNA recognition motif in eukar | 8e-06 | |
| cd12296 | 71 | cd12296, RRM1_Prp24, RNA recognition motif 1 in fu | 8e-06 | |
| cd12496 | 74 | cd12496, RRM3_RBM46, RNA recognition motif 3 in ve | 8e-06 | |
| cd12334 | 74 | cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp | 9e-06 | |
| cd12392 | 81 | cd12392, RRM2_SART3, RNA recognition motif 2 in sq | 9e-06 | |
| cd12247 | 72 | cd12247, RRM2_U1A_like, RNA recognition motif 2 in | 1e-05 | |
| cd12290 | 80 | cd12290, RRM1_LARP7, RNA recognition motif 1 in La | 1e-05 | |
| cd12450 | 77 | cd12450, RRM1_NUCLs, RNA recognition motif 1 found | 1e-05 | |
| PLN03134 | 144 | PLN03134, PLN03134, glycine-rich RNA-binding prote | 1e-05 | |
| cd12552 | 77 | cd12552, RRM_Nop15p, RNA recognition motif in yeas | 1e-05 | |
| cd12223 | 84 | cd12223, RRM_SR140, RNA recognition motif (RRM) in | 1e-05 | |
| cd12408 | 77 | cd12408, RRM_eIF3G_like, RNA recognition motif in | 1e-05 | |
| cd12305 | 75 | cd12305, RRM_NELFE, RNA recognition motif in negat | 1e-05 | |
| cd12398 | 75 | cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot | 1e-05 | |
| cd12447 | 76 | cd12447, RRM1_gar2, RNA recognition motif 1 in yea | 2e-05 | |
| cd12378 | 80 | cd12378, RRM1_I_PABPs, RNA recognition motif 1 in | 2e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-05 | |
| cd12297 | 78 | cd12297, RRM2_Prp24, RNA recognition motif 2 in fu | 2e-05 | |
| cd12381 | 79 | cd12381, RRM4_I_PABPs, RNA recognition motif 4 in | 2e-05 | |
| cd12362 | 73 | cd12362, RRM3_CELF1-6, RNA recognition motif 3 in | 2e-05 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 2e-05 | |
| cd12241 | 77 | cd12241, RRM_SF3B14, RNA recognition motif found i | 3e-05 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 3e-05 | |
| cd12377 | 78 | cd12377, RRM3_Hu, RNA recognition motif 3 in the H | 3e-05 | |
| cd12332 | 71 | cd12332, RRM1_p54nrb_like, RNA recognition motif 1 | 3e-05 | |
| cd12232 | 89 | cd12232, RRM3_U2AF65, RNA recognition motif 3 foun | 4e-05 | |
| cd12227 | 77 | cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in | 5e-05 | |
| cd12335 | 83 | cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp | 5e-05 | |
| cd12318 | 82 | cd12318, RRM5_RBM19_like, RNA recognition motif 5 | 5e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 6e-05 | |
| cd12238 | 73 | cd12238, RRM1_RBM40_like, RNA recognition motif 1 | 6e-05 | |
| cd12358 | 73 | cd12358, RRM1_VICKZ, RNA recognition motif 1 in th | 6e-05 | |
| cd12224 | 74 | cd12224, RRM_RBM22, RNA recognition motif (RRM) fo | 7e-05 | |
| cd12324 | 88 | cd12324, RRM_RBM8, RNA recognition motif in RNA-bi | 7e-05 | |
| cd12309 | 79 | cd12309, RRM2_Spen, RNA recognition motif 2 in the | 7e-05 | |
| cd12605 | 69 | cd12605, RRM_RALYL, RNA recognition motif in verte | 8e-05 | |
| cd12524 | 77 | cd12524, RRM1_MEI2_like, RNA recognition motif 1 i | 9e-05 | |
| cd12374 | 85 | cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti | 9e-05 | |
| cd12411 | 89 | cd12411, RRM_ist3_like, RNA recognition motif in i | 9e-05 | |
| cd12401 | 76 | cd12401, RRM_eIF4H, RNA recognition motif in eukar | 9e-05 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 1e-04 | |
| cd12642 | 79 | cd12642, RRM_TRA2A, RNA recognition motif in trans | 1e-04 | |
| cd12528 | 81 | cd12528, RRM2_MEI2_fungi, RNA recognition motif 2 | 1e-04 | |
| COG0724 | 306 | COG0724, COG0724, RNA-binding proteins (RRM domain | 1e-04 | |
| cd12361 | 77 | cd12361, RRM1_2_CELF1-6_like, RNA recognition moti | 1e-04 | |
| TIGR01648 | 578 | TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu | 1e-04 | |
| cd12567 | 79 | cd12567, RRM3_RBM19, RNA recognition motif 3 in RN | 1e-04 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 1e-04 | |
| cd12579 | 80 | cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in | 1e-04 | |
| cd12370 | 76 | cd12370, RRM1_PUF60, RNA recognition motif 1 in (U | 1e-04 | |
| PTZ00368 | 148 | PTZ00368, PTZ00368, universal minicircle sequence | 2e-04 | |
| cd12771 | 83 | cd12771, RRM1_HuB, RNA recognition motif 1 in vert | 2e-04 | |
| cd12384 | 76 | cd12384, RRM_RBM24_RBM38_like, RNA recognition mot | 2e-04 | |
| cd12615 | 74 | cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc | 2e-04 | |
| cd12346 | 72 | cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti | 2e-04 | |
| cd12231 | 77 | cd12231, RRM2_U2AF65, RNA recognition motif 2 foun | 2e-04 | |
| cd12239 | 82 | cd12239, RRM2_RBM40_like, RNA recognition motif 2 | 2e-04 | |
| cd12616 | 81 | cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc | 2e-04 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 3e-04 | |
| cd12372 | 76 | cd12372, RRM_CFIm68_CFIm59, RNA recognition motif | 3e-04 | |
| cd12772 | 84 | cd12772, RRM1_HuC, RNA recognition motif 1 in vert | 3e-04 | |
| cd12336 | 75 | cd12336, RRM_RBM7_like, RNA recognition motif in R | 3e-04 | |
| cd12393 | 78 | cd12393, RRM_ZCRB1, RNA recognition motif in Zinc | 3e-04 | |
| pfam00098 | 18 | pfam00098, zf-CCHC, Zinc knuckle | 3e-04 | |
| cd12412 | 80 | cd12412, RRM_DAZL_BOULE, RNA recognition motif in | 3e-04 | |
| cd12674 | 79 | cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye | 3e-04 | |
| cd12326 | 79 | cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou | 3e-04 | |
| cd12576 | 75 | cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- | 3e-04 | |
| cd12650 | 78 | cd12650, RRM1_Hu, RNA recognition motif 1 in the H | 4e-04 | |
| cd12260 | 85 | cd12260, RRM2_SREK1, RNA recognition motif 2 in sp | 4e-04 | |
| cd12405 | 72 | cd12405, RRM3_NCL, RNA recognition motif 3 in vert | 4e-04 | |
| cd12773 | 84 | cd12773, RRM2_HuR, RNA recognition motif 2 in vert | 4e-04 | |
| cd12446 | 84 | cd12446, RRM_RBM25, RNA recognition motif in eukar | 4e-04 | |
| pfam06075 | 564 | pfam06075, DUF936, Plant protein of unknown functi | 6e-04 | |
| cd12536 | 85 | cd12536, RRM1_RBM39, RNA recognition motif 1 in ve | 6e-04 | |
| cd12406 | 78 | cd12406, RRM4_NCL, RNA recognition motif 4 in vert | 6e-04 | |
| cd12389 | 77 | cd12389, RRM2_RAVER, RNA recognition motif 2 in ri | 7e-04 | |
| cd12681 | 69 | cd12681, RRM_SKAR, RNA recognition motif in S6K1 A | 7e-04 | |
| cd12299 | 71 | cd12299, RRM4_Prp24, RNA recognition motif 4 in fu | 8e-04 | |
| cd12269 | 69 | cd12269, RRM_Vip1_like, RNA recognition motif in a | 9e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.001 | |
| cd12652 | 79 | cd12652, RRM2_Hu, RNA recognition motif 2 in the H | 0.001 | |
| cd12353 | 75 | cd12353, RRM2_TIA1_like, RNA recognition motif 2 i | 0.001 | |
| cd12330 | 75 | cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye | 0.001 | |
| smart00343 | 17 | smart00343, ZnF_C2HC, zinc finger | 0.001 | |
| cd12379 | 77 | cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou | 0.001 | |
| cd12344 | 81 | cd12344, RRM1_SECp43_like, RNA recognition motif 1 | 0.001 | |
| cd12539 | 103 | cd12539, RRM_U2AF35B, RNA recognition motif in spl | 0.001 | |
| TIGR01622 | 457 | TIGR01622, SF-CC1, splicing factor, CC1-like famil | 0.001 | |
| TIGR01661 | 352 | TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f | 0.001 | |
| cd12575 | 74 | cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 | 0.001 | |
| cd12243 | 71 | cd12243, RRM1_MSSP, RNA recognition motif 1 in the | 0.001 | |
| PTZ00368 | 148 | PTZ00368, PTZ00368, universal minicircle sequence | 0.002 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 0.002 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 0.002 | |
| smart00343 | 17 | smart00343, ZnF_C2HC, zinc finger | 0.002 | |
| cd12253 | 79 | cd12253, RRM_PIN4_like, RNA recognition motif in y | 0.002 | |
| cd12770 | 83 | cd12770, RRM1_HuD, RNA recognition motif 1 in vert | 0.002 | |
| cd12429 | 74 | cd12429, RRM_DNAJC17, RNA recognition motif in the | 0.002 | |
| cd12242 | 73 | cd12242, RRM_SLIRP, RNA recognition motif found in | 0.002 | |
| cd12578 | 78 | cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 | 0.002 | |
| PLN03120 | 260 | PLN03120, PLN03120, nucleic acid binding protein; | 0.002 | |
| cd12588 | 71 | cd12588, RRM1_p54nrb, RNA recognition motif 1 in v | 0.002 | |
| cd12323 | 74 | cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- | 0.002 | |
| cd12376 | 79 | cd12376, RRM2_Hu_like, RNA recognition motif 2 in | 0.002 | |
| TIGR01622 | 457 | TIGR01622, SF-CC1, splicing factor, CC1-like famil | 0.003 | |
| cd12397 | 73 | cd12397, RRM2_Nop13p_fungi, RNA recognition motif | 0.003 | |
| cd12756 | 74 | cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h | 0.003 | |
| cd12776 | 81 | cd12776, RRM2_HuC, RNA recognition motif 2 in vert | 0.003 | |
| cd12574 | 82 | cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D | 0.003 | |
| cd12371 | 77 | cd12371, RRM2_PUF60, RNA recognition motif 2 in (U | 0.003 | |
| TIGR01645 | 612 | TIGR01645, half-pint, poly-U binding splicing fact | 0.003 | |
| cd12486 | 78 | cd12486, RRM1_ACF, RNA recognition motif 1 found i | 0.003 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 0.004 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 0.004 | |
| cd12307 | 74 | cd12307, RRM_NIFK_like, RNA recognition motif in n | 0.004 | |
| cd12571 | 79 | cd12571, RRM6_RBM19, RNA recognition motif 6 in RN | 0.004 | |
| cd12424 | 71 | cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 | 0.004 | |
| cd12689 | 80 | cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 | 0.004 | |
| cd12774 | 81 | cd12774, RRM2_HuD, RNA recognition motif 2 in vert | 0.004 | |
| cd12357 | 89 | cd12357, RRM_PPARGC1A_like, RNA recognition motif | 0.004 | |
| cd12292 | 75 | cd12292, RRM2_La_like, RNA recognition motif 2 in | 0.004 |
| >gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins | Back alignment and domain information |
|---|
Score = 93.2 bits (232), Expect = 3e-24
Identities = 42/70 (60%), Positives = 53/70 (75%)
Query: 12 RLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADDARYSLNGRDVDG 71
R+Y+GRL R R RD+E F YGRIR++++K F FVEF DPRDADDA Y LNG+++ G
Sbjct: 1 RVYIGRLPYRARERDVERFFKGYGRIREINLKNGFGFVEFEDPRDADDAVYELNGKELCG 60
Query: 72 SRIIVEFARG 81
R+IVE ARG
Sbjct: 61 ERVIVEHARG 70
|
This subfamily corresponds to the RRM1 in three serine/arginine (SR) proteins: serine/arginine-rich splicing factor 4 (SRSF4 or SRp75 or SFRS4), serine/arginine-rich splicing factor 5 (SRSF5 or SRp40 or SFRS5 or HRS), serine/arginine-rich splicing factor 6 (SRSF6 or SRp55). SRSF4 plays an important role in both, constitutive and alternative, splicing of many pre-mRNAs. It can shuttle between the nucleus and cytoplasm. SRSF5 regulates both alternative splicing and basal splicing. It is the only SR protein efficiently selected from nuclear extracts (NE) by the splicing enhancer (ESE) and essential for enhancer activation. SRSF6 preferentially interacts with a number of purine-rich splicing enhancers (ESEs) to activate splicing of the ESE-containing exon. It is the only protein from HeLa nuclear extract or purified SR proteins that specifically binds B element RNA after UV irradiation. SRSF6 may also recognize different types of RNA sites. Members in this family contain two N-terminal RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), followed by a C-terminal RS domains rich in serine-arginine dipeptides. . Length = 70 |
| >gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) | Back alignment and domain information |
|---|
| >gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214636 smart00360, RRM, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) | Back alignment and domain information |
|---|
| >gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) | Back alignment and domain information |
|---|
| >gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) | Back alignment and domain information |
|---|
| >gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a | Back alignment and domain information |
|---|
| >gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif | Back alignment and domain information |
|---|
| >gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) | Back alignment and domain information |
|---|
| >gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) | Back alignment and domain information |
|---|
| >gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) | Back alignment and domain information |
|---|
| >gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp | Back alignment and domain information |
|---|
| >gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR | Back alignment and domain information |
|---|
| >gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) | Back alignment and domain information |
|---|
| >gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 | Back alignment and domain information |
|---|
| >gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) | Back alignment and domain information |
|---|
| >gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) | Back alignment and domain information |
|---|
| >gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) | Back alignment and domain information |
|---|
| >gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants | Back alignment and domain information |
|---|
| >gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) | Back alignment and domain information |
|---|
| >gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) | Back alignment and domain information |
|---|
| >gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family | Back alignment and domain information |
|---|
| >gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) | Back alignment and domain information |
|---|
| >gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants | Back alignment and domain information |
|---|
| >gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) | Back alignment and domain information |
|---|
| >gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family | Back alignment and domain information |
|---|
| >gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) | Back alignment and domain information |
|---|
| >gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) | Back alignment and domain information |
|---|
| >gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly | Back alignment and domain information |
|---|
| >gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240815 cd12369, RRM4_RBM45, RNA recognition motif 4 in RNA-binding protein 45 (RBM45) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240913 cd12467, RRM_Srp1p_like, RNA recognition motif 1 in fission yeast pre-mRNA-splicing factor Srp1p and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227414 COG5082, AIR1, Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family | Back alignment and domain information |
|---|
| >gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family | Back alignment and domain information |
|---|
| >gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240940 cd12496, RRM3_RBM46, RNA recognition motif 3 in vertebrate RNA-binding protein 46 (RBM46) | Back alignment and domain information |
|---|
| >gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family | Back alignment and domain information |
|---|
| >gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants | Back alignment and domain information |
|---|
| >gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family | Back alignment and domain information |
|---|
| >gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family | Back alignment and domain information |
|---|
| >gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family | Back alignment and domain information |
|---|
| >gnl|CDD|241049 cd12605, RRM_RALYL, RNA recognition motif in vertebrate RNA-binding Raly-like protein (RALYL) | Back alignment and domain information |
|---|
| >gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family | Back alignment and domain information |
|---|
| >gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240972 cd12528, RRM2_MEI2_fungi, RNA recognition motif 2 in fungal Mei2-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA | Back alignment and domain information |
|---|
| >gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) | Back alignment and domain information |
|---|
| >gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) | Back alignment and domain information |
|---|
| >gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|189387 pfam00098, zf-CCHC, Zinc knuckle | Back alignment and domain information |
|---|
| >gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE | Back alignment and domain information |
|---|
| >gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family | Back alignment and domain information |
|---|
| >gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin | Back alignment and domain information |
|---|
| >gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) | Back alignment and domain information |
|---|
| >gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|218883 pfam06075, DUF936, Plant protein of unknown function (DUF936) | Back alignment and domain information |
|---|
| >gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) | Back alignment and domain information |
|---|
| >gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin | Back alignment and domain information |
|---|
| >gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240745 cd12299, RRM4_Prp24, RNA recognition motif 4 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240715 cd12269, RRM_Vip1_like, RNA recognition motif in a group of uncharacterized plant proteins similar to fission yeast Vip1 | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family | Back alignment and domain information |
|---|
| >gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR | Back alignment and domain information |
|---|
| >gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|197667 smart00343, ZnF_C2HC, zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240983 cd12539, RRM_U2AF35B, RNA recognition motif in splicing factor U2AF 35 kDa subunit B (U2AF35B) | Back alignment and domain information |
|---|
| >gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family | Back alignment and domain information |
|---|
| >gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197667 smart00343, ZnF_C2HC, zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|240699 cd12253, RRM_PIN4_like, RNA recognition motif in yeast RNA-binding protein PIN4, fission yeast RNA-binding post-transcriptional regulators cip1, cip2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) | Back alignment and domain information |
|---|
| >gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 | Back alignment and domain information |
|---|
| >gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215588 PLN03120, PLN03120, nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) | Back alignment and domain information |
|---|
| >gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) | Back alignment and domain information |
|---|
| >gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240870 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241133 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) | Back alignment and domain information |
|---|
| >gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators | Back alignment and domain information |
|---|
| >gnl|CDD|240738 cd12292, RRM2_La_like, RNA recognition motif 2 in La autoantigen (La or SS-B or LARP3), La-related protein 7 (LARP7 or PIP7S) and similar proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 310 | |||
| KOG0107 | 195 | consensus Alternative splicing factor SRp20/9G8 (R | 99.95 | |
| KOG4207 | 256 | consensus Predicted splicing factor, SR protein su | 99.8 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 99.74 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 99.71 | |
| KOG0105 | 241 | consensus Alternative splicing factor ASF/SF2 (RRM | 99.7 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 99.68 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 99.59 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 99.55 | |
| PF00076 | 70 | RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or | 99.54 | |
| KOG0121 | 153 | consensus Nuclear cap-binding protein complex, sub | 99.52 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 99.51 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 99.5 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 99.49 | |
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 99.49 | |
| KOG0125 | 376 | consensus Ataxin 2-binding protein (RRM superfamil | 99.47 | |
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 99.46 | |
| KOG0122 | 270 | consensus Translation initiation factor 3, subunit | 99.45 | |
| KOG0130 | 170 | consensus RNA-binding protein RBM8/Tsunagi (RRM su | 99.44 | |
| KOG0117 | 506 | consensus Heterogeneous nuclear ribonucleoprotein | 99.44 | |
| KOG0113 | 335 | consensus U1 small nuclear ribonucleoprotein (RRM | 99.43 | |
| PLN03213 | 759 | repressor of silencing 3; Provisional | 99.43 | |
| KOG0149 | 247 | consensus Predicted RNA-binding protein SEB4 (RRM | 99.41 | |
| KOG0148 | 321 | consensus Apoptosis-promoting RNA-binding protein | 99.4 | |
| PF14259 | 70 | RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or | 99.38 | |
| smart00362 | 72 | RRM_2 RNA recognition motif. | 99.38 | |
| KOG0114 | 124 | consensus Predicted RNA-binding protein (RRM super | 99.36 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 99.35 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 99.35 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 99.34 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 99.33 | |
| KOG0131 | 203 | consensus Splicing factor 3b, subunit 4 [RNA proce | 99.33 | |
| cd00590 | 74 | RRM RRM (RNA recognition motif), also known as RBD | 99.3 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 99.29 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 99.28 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 99.28 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 99.27 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 99.26 | |
| smart00360 | 71 | RRM RNA recognition motif. | 99.26 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 99.26 | |
| KOG0106 | 216 | consensus Alternative splicing factor SRp55/B52/SR | 99.26 | |
| KOG0111 | 298 | consensus Cyclophilin-type peptidyl-prolyl cis-tra | 99.25 | |
| KOG0415 | 479 | consensus Predicted peptidyl prolyl cis-trans isom | 99.25 | |
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 99.24 | |
| COG0724 | 306 | RNA-binding proteins (RRM domain) [General functio | 99.23 | |
| KOG0117 | 506 | consensus Heterogeneous nuclear ribonucleoprotein | 99.21 | |
| KOG0126 | 219 | consensus Predicted RNA-binding protein (RRM super | 99.2 | |
| KOG4212 | 608 | consensus RNA-binding protein hnRNP-M [RNA process | 99.16 | |
| KOG0127 | 678 | consensus Nucleolar protein fibrillarin NOP77 (RRM | 99.16 | |
| KOG0148 | 321 | consensus Apoptosis-promoting RNA-binding protein | 99.14 | |
| KOG0145 | 360 | consensus RNA-binding protein ELAV/HU (RRM superfa | 99.12 | |
| KOG0145 | 360 | consensus RNA-binding protein ELAV/HU (RRM superfa | 99.07 | |
| KOG0146 | 371 | consensus RNA-binding protein ETR-3 (RRM superfami | 99.05 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 99.04 | |
| KOG0144 | 510 | consensus RNA-binding protein CUGBP1/BRUNO (RRM su | 99.04 | |
| KOG0108 | 435 | consensus mRNA cleavage and polyadenylation factor | 99.02 | |
| KOG4206 | 221 | consensus Spliceosomal protein snRNP-U1A/U2B [RNA | 99.0 | |
| KOG0153 | 377 | consensus Predicted RNA-binding protein (RRM super | 98.99 | |
| KOG0144 | 510 | consensus RNA-binding protein CUGBP1/BRUNO (RRM su | 98.97 | |
| KOG0147 | 549 | consensus Transcriptional coactivator CAPER (RRM s | 98.96 | |
| KOG0124 | 544 | consensus Polypyrimidine tract-binding protein PUF | 98.95 | |
| KOG0132 | 894 | consensus RNA polymerase II C-terminal domain-bind | 98.95 | |
| KOG4212 | 608 | consensus RNA-binding protein hnRNP-M [RNA process | 98.95 | |
| KOG4661 | 940 | consensus Hsp27-ERE-TATA-binding protein/Scaffold | 98.95 | |
| smart00361 | 70 | RRM_1 RNA recognition motif. | 98.94 | |
| KOG0116 | 419 | consensus RasGAP SH3 binding protein rasputin, con | 98.94 | |
| KOG0127 | 678 | consensus Nucleolar protein fibrillarin NOP77 (RRM | 98.94 | |
| KOG0106 | 216 | consensus Alternative splicing factor SRp55/B52/SR | 98.88 | |
| KOG0110 | 725 | consensus RNA-binding protein (RRM superfamily) [G | 98.83 | |
| KOG4205 | 311 | consensus RNA-binding protein musashi/mRNA cleavag | 98.8 | |
| KOG0123 | 369 | consensus Polyadenylate-binding protein (RRM super | 98.78 | |
| KOG0533 | 243 | consensus RRM motif-containing protein [RNA proces | 98.76 | |
| KOG0124 | 544 | consensus Polypyrimidine tract-binding protein PUF | 98.76 | |
| KOG4454 | 267 | consensus RNA binding protein (RRM superfamily) [G | 98.73 | |
| KOG0110 | 725 | consensus RNA-binding protein (RRM superfamily) [G | 98.7 | |
| KOG0131 | 203 | consensus Splicing factor 3b, subunit 4 [RNA proce | 98.68 | |
| KOG1457 | 284 | consensus RNA binding protein (contains RRM repeat | 98.68 | |
| KOG4676 | 479 | consensus Splicing factor, arginine/serine-rich [R | 98.67 | |
| KOG0151 | 877 | consensus Predicted splicing regulator, contains R | 98.67 | |
| KOG4208 | 214 | consensus Nucleolar RNA-binding protein NIFK [Gene | 98.62 | |
| KOG4205 | 311 | consensus RNA-binding protein musashi/mRNA cleavag | 98.58 | |
| PF08777 | 105 | RRM_3: RNA binding motif; InterPro: IPR014886 This | 98.57 | |
| KOG0105 | 241 | consensus Alternative splicing factor ASF/SF2 (RRM | 98.56 | |
| PF11608 | 90 | Limkain-b1: Limkain b1; InterPro: IPR024582 This e | 98.53 | |
| KOG1548 | 382 | consensus Transcription elongation factor TAT-SF1 | 98.53 | |
| KOG0146 | 371 | consensus RNA-binding protein ETR-3 (RRM superfami | 98.52 | |
| KOG4209 | 231 | consensus Splicing factor RNPS1, SR protein superf | 98.42 | |
| KOG0123 | 369 | consensus Polyadenylate-binding protein (RRM super | 98.41 | |
| KOG4660 | 549 | consensus Protein Mei2, essential for commitment t | 98.36 | |
| KOG1190 | 492 | consensus Polypyrimidine tract-binding protein [RN | 98.25 | |
| PF04059 | 97 | RRM_2: RNA recognition motif 2; InterPro: IPR00720 | 98.21 | |
| KOG1457 | 284 | consensus RNA binding protein (contains RRM repeat | 98.2 | |
| KOG1995 | 351 | consensus Conserved Zn-finger protein [General fun | 98.08 | |
| KOG4211 | 510 | consensus Splicing factor hnRNP-F and related RNA- | 98.04 | |
| KOG1456 | 494 | consensus Heterogeneous nuclear ribonucleoprotein | 97.99 | |
| KOG4206 | 221 | consensus Spliceosomal protein snRNP-U1A/U2B [RNA | 97.95 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 97.94 | |
| PF14605 | 53 | Nup35_RRM_2: Nup53/35/40-type RNA recognition moti | 97.88 | |
| KOG4676 | 479 | consensus Splicing factor, arginine/serine-rich [R | 97.82 | |
| KOG0120 | 500 | consensus Splicing factor U2AF, large subunit (RRM | 97.82 | |
| KOG1855 | 484 | consensus Predicted RNA-binding protein [General f | 97.77 | |
| KOG4211 | 510 | consensus Splicing factor hnRNP-F and related RNA- | 97.77 | |
| KOG0226 | 290 | consensus RNA-binding proteins [General function p | 97.72 | |
| KOG2202 | 260 | consensus U2 snRNP splicing factor, small subunit, | 97.61 | |
| PF05172 | 100 | Nup35_RRM: Nup53/35/40-type RNA recognition motif; | 97.61 | |
| KOG2416 | 718 | consensus Acinus (induces apoptotic chromatin cond | 97.6 | |
| KOG1456 | 494 | consensus Heterogeneous nuclear ribonucleoprotein | 97.58 | |
| KOG0147 | 549 | consensus Transcriptional coactivator CAPER (RRM s | 97.56 | |
| KOG1548 | 382 | consensus Transcription elongation factor TAT-SF1 | 97.53 | |
| KOG3152 | 278 | consensus TBP-binding protein, activator of basal | 97.5 | |
| PF08952 | 146 | DUF1866: Domain of unknown function (DUF1866) ; In | 97.5 | |
| KOG1190 | 492 | consensus Polypyrimidine tract-binding protein [RN | 97.45 | |
| KOG4210 | 285 | consensus Nuclear localization sequence binding pr | 97.43 | |
| KOG0129 | 520 | consensus Predicted RNA-binding protein (RRM super | 97.41 | |
| KOG0112 | 975 | consensus Large RNA-binding protein (RRM superfami | 97.33 | |
| KOG0120 | 500 | consensus Splicing factor U2AF, large subunit (RRM | 97.2 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 97.08 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 97.07 | |
| KOG1996 | 378 | consensus mRNA splicing factor [RNA processing and | 97.02 | |
| PF03880 | 74 | DbpA: DbpA RNA binding domain ; InterPro: IPR00558 | 97.01 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 96.93 | |
| KOG4307 | 944 | consensus RNA binding protein RBM12/SWAN [General | 96.92 | |
| KOG0129 | 520 | consensus Predicted RNA-binding protein (RRM super | 96.81 | |
| PF10309 | 62 | DUF2414: Protein of unknown function (DUF2414); In | 96.76 | |
| KOG2068 | 327 | consensus MOT2 transcription factor [Transcription | 96.66 | |
| KOG4207 | 256 | consensus Predicted splicing factor, SR protein su | 96.61 | |
| KOG0112 | 975 | consensus Large RNA-binding protein (RRM superfami | 96.56 | |
| KOG1365 | 508 | consensus RNA-binding protein Fusilli, contains RR | 96.47 | |
| KOG4307 | 944 | consensus RNA binding protein RBM12/SWAN [General | 96.33 | |
| KOG2135 | 526 | consensus Proteins containing the RNA recognition | 96.23 | |
| PF03467 | 176 | Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 | 96.13 | |
| KOG2253 | 668 | consensus U1 snRNP complex, subunit SNU71 and rela | 96.06 | |
| PF00098 | 18 | zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi | 95.92 | |
| KOG1365 | 508 | consensus RNA-binding protein Fusilli, contains RR | 95.61 | |
| PF08675 | 87 | RNA_bind: RNA binding domain; InterPro: IPR014789 | 95.51 | |
| KOG2591 | 684 | consensus c-Mpl binding protein, contains La domai | 95.4 | |
| PF15023 | 166 | DUF4523: Protein of unknown function (DUF4523) | 95.39 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 95.31 | |
| PF04847 | 184 | Calcipressin: Calcipressin; InterPro: IPR006931 Ca | 95.3 | |
| PF07576 | 110 | BRAP2: BRCA1-associated protein 2; InterPro: IPR01 | 95.26 | |
| COG5082 | 190 | AIR1 Arginine methyltransferase-interacting protei | 95.05 | |
| KOG0128 | 881 | consensus RNA-binding protein SART3 (RRM superfami | 95.04 | |
| KOG0115 | 275 | consensus RNA-binding protein p54nrb (RRM superfam | 94.89 | |
| KOG4285 | 350 | consensus Mitotic phosphoprotein [Cell cycle contr | 94.82 | |
| PTZ00368 | 148 | universal minicircle sequence binding protein (UMS | 94.7 | |
| KOG4019 | 193 | consensus Calcineurin-mediated signaling pathway i | 94.61 | |
| KOG0128 | 881 | consensus RNA-binding protein SART3 (RRM superfami | 94.55 | |
| KOG4574 | 1007 | consensus RNA-binding protein (contains RRM and Pu | 94.4 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 94.36 | |
| KOG0107 | 195 | consensus Alternative splicing factor SRp20/9G8 (R | 94.18 | |
| PTZ00368 | 148 | universal minicircle sequence binding protein (UMS | 93.95 | |
| COG5082 | 190 | AIR1 Arginine methyltransferase-interacting protei | 93.16 | |
| KOG4400 | 261 | consensus E3 ubiquitin ligase interacting with arg | 92.39 | |
| PF11767 | 66 | SET_assoc: Histone lysine methyltransferase SET as | 92.29 | |
| KOG2318 | 650 | consensus Uncharacterized conserved protein [Funct | 92.26 | |
| KOG4660 | 549 | consensus Protein Mei2, essential for commitment t | 92.12 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 91.94 | |
| PF00098 | 18 | zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi | 91.79 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 90.04 | |
| KOG4210 | 285 | consensus Nuclear localization sequence binding pr | 89.07 | |
| KOG2891 | 445 | consensus Surface glycoprotein [General function p | 88.9 | |
| PF13917 | 42 | zf-CCHC_3: Zinc knuckle | 84.07 | |
| KOG4483 | 528 | consensus Uncharacterized conserved protein [Funct | 83.57 | |
| KOG1295 | 376 | consensus Nonsense-mediated decay protein Upf3 [RN | 83.46 | |
| PRK10629 | 127 | EnvZ/OmpR regulon moderator; Provisional | 80.44 |
| >KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=99.95 E-value=4.7e-27 Score=195.00 Aligned_cols=114 Identities=55% Similarity=1.008 Sum_probs=92.3
Q ss_pred CCCCCCCCCCcEEEEccCCCCCcHHHHHHHHHhcCCeeEEEEeC---CeEEEEECCHHHHHHHHHhcCCcccCCCceeee
Q 021599 1 MPRYDDRYGGTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKR---DFAFVEFSDPRDADDARYSLNGRDVDGSRIIVE 77 (310)
Q Consensus 1 m~~~~~~~~~~~l~V~nL~~~~te~dL~~~F~~~G~V~~v~i~~---~~afV~F~~~eda~~Ai~~lng~~l~Gr~I~V~ 77 (310)
||.+++.+.+++|||+||+..+++.||+.+|..||.|..|.|.. +||||||++..||++|+..|||..|+|..|.||
T Consensus 1 m~r~~~~~~~~kVYVGnL~~~a~k~eLE~~F~~yG~lrsvWvArnPPGfAFVEFed~RDA~DAvr~LDG~~~cG~r~rVE 80 (195)
T KOG0107|consen 1 MPRYRDRNGNTKVYVGNLGSRATKRELERAFSKYGPLRSVWVARNPPGFAFVEFEDPRDAEDAVRYLDGKDICGSRIRVE 80 (195)
T ss_pred CCcccccCCCceEEeccCCCCcchHHHHHHHHhcCcceeEEEeecCCCceEEeccCcccHHHHHhhcCCccccCceEEEE
Confidence 99999999999999999999999999999999999999998854 699999999999999999999999999999999
Q ss_pred eccCCCCCCCCCCCccCCCCCCCCCCCccCCCCCCCCccCC
Q 021599 78 FARGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCK 118 (310)
Q Consensus 78 ~ak~~~~~~~g~~~~~grg~~~~~~rc~~~G~~g~~~rdc~ 118 (310)
+.+..+++..++ +.. ++.+...|+.||..|||..+|.
T Consensus 81 ~S~G~~r~~r~g---g~~-~~~g~~~~~r~G~rg~~~r~~~ 117 (195)
T KOG0107|consen 81 LSTGRPRGSRRG---GSR-PPRGRGFCYRCGERGHIGRNCK 117 (195)
T ss_pred eecCCccccccC---CCC-CcccccccccCCCccccccccc
Confidence 999887753321 111 2222233555555555554443
|
|
| >KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >PF00076 RRM_1: RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03213 repressor of silencing 3; Provisional | Back alignment and domain information |
|---|
| >KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14259 RRM_6: RNA recognition motif (a | Back alignment and domain information |
|---|
| >smart00362 RRM_2 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >smart00360 RRM RNA recognition motif | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
| >COG0724 RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] | Back alignment and domain information |
|---|
| >KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] | Back alignment and domain information |
|---|
| >KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] | Back alignment and domain information |
|---|
| >smart00361 RRM_1 RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0533 consensus RRM motif-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation | Back alignment and domain information |
|---|
| >KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes | Back alignment and domain information |
|---|
| >KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 | Back alignment and domain information |
|---|
| >KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1995 consensus Conserved Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif | Back alignment and domain information |
|---|
| >KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1855 consensus Predicted RNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0226 consensus RNA-binding proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] | Back alignment and domain information |
|---|
| >KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] | Back alignment and domain information |
|---|
| >KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] | Back alignment and domain information |
|---|
| >PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function | Back alignment and domain information |
|---|
| >KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4210 consensus Nuclear localization sequence binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1996 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >KOG2068 consensus MOT2 transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] | Back alignment and domain information |
|---|
| >PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons | Back alignment and domain information |
|---|
| >KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) | Back alignment and domain information |
|---|
| >KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15023 DUF4523: Protein of unknown function (DUF4523) | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells | Back alignment and domain information |
|---|
| >PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] | Back alignment and domain information |
|---|
| >COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >KOG4019 consensus Calcineurin-mediated signaling pathway inhibitor DSCR1 [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes | Back alignment and domain information |
|---|
| >KOG2318 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >KOG4210 consensus Nuclear localization sequence binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2891 consensus Surface glycoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13917 zf-CCHC_3: Zinc knuckle | Back alignment and domain information |
|---|
| >KOG4483 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1295 consensus Nonsense-mediated decay protein Upf3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10629 EnvZ/OmpR regulon moderator; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 310 | ||||
| 1x4a_A | 109 | Solution Structure Of Rrm Domain In Splicing Factor | 5e-14 | ||
| 2hvz_A | 101 | Solution Structure Of The Rrm Domain Of Sr Rich Fac | 1e-09 | ||
| 2i2y_A | 150 | Solution Structure Of The Rrm Of Srp20 Bound To The | 4e-09 | ||
| 1x5s_A | 102 | Solution Structure Of Rrm Domain In A18 Hnrnp Lengt | 5e-09 | ||
| 2i38_A | 150 | Solution Structure Of The Rrm Of Srp20 Length = 150 | 6e-09 | ||
| 2lea_A | 135 | Solution Structure Of Human Srsf2 (Sc35) Rrm Length | 2e-07 | ||
| 2kxn_B | 129 | Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit | 3e-07 | ||
| 2kn4_A | 158 | The Structure Of The Rrm Domain Of Sc35 Length = 15 | 4e-07 | ||
| 2fy1_A | 116 | A Dual Mode Of Rna Recognition By The Rbmy Protein | 4e-07 | ||
| 2rra_A | 99 | Solution Structure Of Rna Binding Domain In Human T | 5e-07 | ||
| 2dnp_A | 90 | Solution Structure Of Rna Binding Domain 2 In Rna-B | 6e-07 | ||
| 2rrb_A | 96 | Refinement Of Rna Binding Domain In Human Tra2 Beta | 6e-07 | ||
| 1wf1_A | 110 | Solution Structure Of Rrm Domain In Rna-Binding Pro | 1e-06 | ||
| 4a8x_A | 88 | Structure Of The Core Asap Complex Length = 88 | 2e-06 | ||
| 2dnm_A | 103 | Solution Structure Of Rna Binding Domain In Srp46 S | 2e-06 | ||
| 2cqc_A | 95 | Solution Structure Of The Rna Recognition Motif In | 3e-06 | ||
| 1wf2_A | 98 | Solution Structure Of Rrm Domain In Hnrpc Protein L | 5e-06 | ||
| 2err_A | 109 | Nmr Structure Of The Rna Binding Domain Of Human Fo | 6e-06 | ||
| 2cq3_A | 103 | Solution Structure Of Rna Binding Domain In Rna Bin | 6e-06 | ||
| 2dgu_A | 103 | Solution Structure Of The Rna Binding Domain In Het | 7e-05 | ||
| 2xnr_A | 97 | Structural Insights Into Cis Element Recognition Of | 2e-04 | ||
| 2xnq_A | 97 | Structural Insights Into Cis Element Recognition Of | 2e-04 | ||
| 2l41_A | 77 | Nab3 Rrm - Ucuu Complex Length = 77 | 2e-04 | ||
| 2cq4_A | 114 | Solution Structure Of Rna Binding Domain In Rna Bin | 3e-04 | ||
| 2kvi_A | 96 | Structure Of Nab3 Rrm Length = 96 | 3e-04 | ||
| 2dnq_A | 90 | Solution Structure Of Rna Binding Domain 1 In Rna-B | 5e-04 | ||
| 1h2t_Z | 156 | Structure Of The Human Nuclear Cap-Binding-Complex | 7e-04 |
| >pdb|1X4A|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor Sf2 Length = 109 | Back alignment and structure |
|
| >pdb|2HVZ|A Chain A, Solution Structure Of The Rrm Domain Of Sr Rich Factor 9g8 Length = 101 | Back alignment and structure |
| >pdb|2I2Y|A Chain A, Solution Structure Of The Rrm Of Srp20 Bound To The Rna Cauc Length = 150 | Back alignment and structure |
| >pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 | Back alignment and structure |
| >pdb|2I38|A Chain A, Solution Structure Of The Rrm Of Srp20 Length = 150 | Back alignment and structure |
| >pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 | Back alignment and structure |
| >pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 | Back alignment and structure |
| >pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 | Back alignment and structure |
| >pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 | Back alignment and structure |
| >pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 | Back alignment and structure |
| >pdb|2DNP|A Chain A, Solution Structure Of Rna Binding Domain 2 In Rna-Binding Protein 14 Length = 90 | Back alignment and structure |
| >pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 | Back alignment and structure |
| >pdb|1WF1|A Chain A, Solution Structure Of Rrm Domain In Rna-Binding Protein Np_057951 Length = 110 | Back alignment and structure |
| >pdb|4A8X|A Chain A, Structure Of The Core Asap Complex Length = 88 | Back alignment and structure |
| >pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 | Back alignment and structure |
| >pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 | Back alignment and structure |
| >pdb|1WF2|A Chain A, Solution Structure Of Rrm Domain In Hnrpc Protein Length = 98 | Back alignment and structure |
| >pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 | Back alignment and structure |
| >pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 | Back alignment and structure |
| >pdb|2DGU|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein Q Length = 103 | Back alignment and structure |
| >pdb|2XNR|A Chain A, Structural Insights Into Cis Element Recognition Of Non- Polyadenylated Rnas By The Nab3-Rrm Length = 97 | Back alignment and structure |
| >pdb|2XNQ|A Chain A, Structural Insights Into Cis Element Recognition Of Non- Polyadenylated Rnas By The Nab3-Rrm Length = 97 | Back alignment and structure |
| >pdb|2L41|A Chain A, Nab3 Rrm - Ucuu Complex Length = 77 | Back alignment and structure |
| >pdb|2CQ4|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 23 Length = 114 | Back alignment and structure |
| >pdb|2KVI|A Chain A, Structure Of Nab3 Rrm Length = 96 | Back alignment and structure |
| >pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 | Back alignment and structure |
| >pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) In Complex With A Cap Analogue M7gpppg Length = 156 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 310 | |||
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 2e-30 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 8e-30 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 2e-29 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 3e-29 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 6e-29 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 5e-26 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 8e-26 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 3e-25 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 6e-25 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 1e-24 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 9e-23 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 4e-22 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 2e-21 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 1e-20 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 1e-19 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 2e-19 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 4e-19 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 6e-18 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 5e-17 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 6e-17 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 6e-17 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 1e-16 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 2e-16 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 2e-16 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 3e-16 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 3e-16 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 6e-16 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 4e-09 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 6e-16 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 6e-16 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 8e-16 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 9e-16 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 1e-15 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 1e-15 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 2e-15 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 2e-15 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 2e-15 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 3e-15 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 3e-15 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 3e-15 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 4e-15 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 2e-11 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 4e-15 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 4e-15 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 4e-15 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 5e-15 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 6e-15 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 1e-12 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 6e-15 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 7e-15 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 7e-15 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 8e-15 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 9e-15 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 1e-14 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 1e-14 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 1e-14 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 2e-14 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 2e-14 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 2e-14 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 2e-14 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} Len | 2e-14 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 2e-14 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 2e-14 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 1e-11 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 4e-14 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 4e-14 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 4e-12 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 9e-12 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 5e-14 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 6e-14 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 7e-14 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 8e-14 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 8e-14 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 9e-14 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 5e-11 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 9e-14 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 1e-13 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 1e-12 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 1e-13 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 1e-13 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 2e-13 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 2e-13 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 2e-13 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 2e-13 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 2e-13 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 2e-13 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 4e-11 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 4e-09 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 2e-13 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 2e-12 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 4e-13 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 6e-13 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 9e-13 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 6e-13 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 6e-13 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 6e-13 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 8e-13 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 8e-13 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 1e-12 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 1e-12 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 2e-12 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 3e-12 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 4e-12 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 4e-12 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 5e-12 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 5e-12 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 5e-09 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 6e-12 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 7e-12 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 9e-10 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 9e-12 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 4e-10 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 1e-11 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 1e-11 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 2e-11 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 2e-11 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 2e-11 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 2e-11 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 2e-11 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 1e-09 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 2e-11 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 2e-11 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 2e-11 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 3e-11 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 3e-11 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 3e-11 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 3e-10 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 6e-11 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 9e-11 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 1e-10 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 1e-10 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 2e-10 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 2e-10 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 2e-10 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 2e-10 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 2e-10 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 3e-10 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 4e-10 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 5e-10 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 5e-10 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 9e-09 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 5e-10 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 7e-10 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 7e-10 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 7e-10 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 9e-10 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 9e-10 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 2e-09 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 1e-09 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 1e-09 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 2e-09 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 2e-09 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 2e-09 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 3e-09 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 5e-09 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 5e-09 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 5e-09 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 7e-09 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 2e-08 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 3e-08 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 3e-07 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 4e-08 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 5e-08 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 5e-08 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 6e-08 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 1e-07 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 2e-07 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 2e-07 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 2e-07 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 1e-05 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 2e-04 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 2e-07 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 3e-07 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 3e-07 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 4e-07 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 6e-07 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 7e-07 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 7e-07 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 9e-07 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 1e-06 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 2e-06 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 2e-06 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 2e-06 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 2e-06 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 2e-06 | |
| 3s6e_A | 114 | RNA-binding protein 39; ferredoxin-like, structura | 3e-06 | |
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 4e-06 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 6e-06 | |
| 3v4m_A | 105 | Splicing factor U2AF 65 kDa subunit; canonical RNA | 6e-06 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 1e-05 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 3e-05 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 1e-04 | |
| 3ue2_A | 118 | Poly(U)-binding-splicing factor PUF60; RNA recogni | 1e-04 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 2e-04 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 8e-04 |
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
Score = 109 bits (274), Expect = 2e-30
Identities = 28/82 (34%), Positives = 46/82 (56%)
Query: 9 GGTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADDARYSLNGRD 68
+++VG +++ S++L +F R GR+ + D+ +D+AFV DA A LNG++
Sbjct: 8 NTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKE 67
Query: 69 VDGSRIIVEFARGGPRGPGGSR 90
V G RI VE + G + G S
Sbjct: 68 VKGKRINVELSTKGQKKSGPSS 89
|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Length = 61 | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Length = 148 | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Length = 60 | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Length = 37 | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Length = 124 | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Length = 124 | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Length = 124 | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Length = 39 | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 | Back alignment and structure |
|---|
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Length = 49 | Back alignment and structure |
|---|
| >3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Length = 55 | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 | Back alignment and structure |
|---|
| >3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 310 | |||
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 99.82 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 99.81 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 99.8 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 99.8 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 99.79 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 99.79 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 99.79 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 99.79 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 99.79 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 99.78 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 99.77 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 99.76 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 99.76 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 99.76 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 99.76 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 99.76 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 99.76 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 99.76 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 99.76 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 99.75 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 99.75 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 99.75 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 99.75 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 99.75 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 99.75 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 99.75 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 99.75 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 99.75 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 99.75 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 99.74 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 99.74 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.74 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 99.74 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 99.74 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 99.74 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.74 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 99.73 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.73 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 99.73 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.73 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 99.73 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 99.73 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 99.73 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 99.73 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 99.73 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.73 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 99.73 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 99.73 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 99.73 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 99.73 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 99.73 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 99.73 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 99.73 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 99.73 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 99.73 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 99.72 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 99.72 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 99.72 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 99.72 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 99.72 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 99.72 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 99.72 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 99.72 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 99.72 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 99.72 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 99.71 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 99.71 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 99.71 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 99.71 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 99.71 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 99.71 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 99.71 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 99.71 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 99.71 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 99.7 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.7 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 99.7 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 99.7 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 99.7 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 99.7 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 99.7 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 99.7 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 99.69 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 99.69 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 99.69 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 99.69 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 99.69 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 99.69 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 99.69 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 99.69 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 99.69 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 99.69 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 99.69 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 99.69 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 99.68 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 99.68 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 99.68 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 99.68 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 99.68 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 99.68 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 99.68 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 99.68 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 99.68 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 99.67 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 99.67 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 99.67 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 99.67 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 99.67 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 99.66 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 99.66 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 99.66 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 99.66 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 99.66 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 99.66 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 99.66 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 99.66 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 99.66 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 99.65 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 99.65 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 99.47 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 99.65 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 99.65 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 99.65 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 99.65 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 99.65 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 99.65 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 99.64 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 99.64 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 99.64 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 99.64 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 99.64 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 99.64 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 99.64 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 99.64 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 99.64 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 99.64 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 99.64 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 99.64 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 99.64 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 99.64 | |
| 2m2b_A | 131 | RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio | 99.64 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 99.63 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 99.63 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 99.62 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 99.62 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 99.61 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 99.61 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 99.61 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.61 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 99.61 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 99.6 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 99.6 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 99.6 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 99.59 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 99.57 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 99.57 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 99.56 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 99.56 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 99.55 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 99.55 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.55 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.54 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 99.54 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.53 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 99.53 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 99.53 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 99.52 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 99.51 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 99.51 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 99.5 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 99.5 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 99.5 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.5 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 99.5 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 99.49 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 99.49 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 99.49 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 99.48 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 99.48 | |
| 2j8a_A | 136 | Histone-lysine N-methyltransferase, H3 lysine-4 sp | 99.48 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 99.48 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 99.47 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 99.47 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 99.46 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 99.45 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 99.45 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 99.44 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 99.43 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 99.41 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 99.41 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 99.4 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 99.4 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 99.39 | |
| 2d9o_A | 100 | DNAJ (HSP40) homolog, subfamily C, member 17; RRM | 99.39 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 99.37 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 99.36 | |
| 1owx_A | 121 | Lupus LA protein, SS-B, LA; RRM, transcription; NM | 99.35 | |
| 3tht_A | 345 | Alkylated DNA repair protein ALKB homolog 8; struc | 99.34 | |
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 99.34 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 99.33 | |
| 3v4m_A | 105 | Splicing factor U2AF 65 kDa subunit; canonical RNA | 99.32 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 99.32 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 99.29 | |
| 2dnr_A | 91 | Synaptojanin-1; RRM domain, RBD, structural genomi | 99.27 | |
| 3ue2_A | 118 | Poly(U)-binding-splicing factor PUF60; RNA recogni | 99.27 | |
| 3s6e_A | 114 | RNA-binding protein 39; ferredoxin-like, structura | 99.18 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 99.14 | |
| 1ufw_A | 95 | Synaptojanin 2; RNP domain, structural genomics, r | 99.08 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 98.61 | |
| 2l9w_A | 117 | U4/U6 snRNA-associated-splicing factor PRP24; RRM, | 98.55 | |
| 1wey_A | 104 | Calcipressin 1; structural genomics, RRM domain, r | 98.15 | |
| 2dhx_A | 104 | Poly (ADP-ribose) polymerase family, member 10 var | 98.13 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 98.01 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 97.97 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 97.93 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 97.89 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 97.89 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 97.85 | |
| 1uw4_A | 91 | UPF3X; nonsense mediated mRNA decay protein, RNA-b | 97.82 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 97.8 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 97.76 | |
| 1wwh_A | 119 | Nucleoporin 35, nucleoporin; structural genomics, | 97.65 | |
| 1whv_A | 100 | Poly(A)-specific ribonuclease; RNA recognition mot | 97.41 | |
| 2l08_A | 97 | Regulator of nonsense transcripts 3A; NESG, nonsen | 97.33 | |
| 3ctr_A | 101 | Poly(A)-specific ribonuclease PARN; protein-RNA-co | 97.2 | |
| 3p3d_A | 132 | Nucleoporin 53; structural genomics, PSI-2, protei | 97.04 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 96.99 | |
| 1a6b_B | 40 | Momulv, zinc finger protein NCP10; nucleocapsid pr | 96.78 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 96.28 | |
| 1u6p_A | 56 | GAG polyprotein; MLV, A-minor K-turn, stem loop, b | 96.22 | |
| 1dsq_A | 26 | Nucleic acid binding protein P14; CCHC type zinc f | 96.17 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 96.14 | |
| 3pq1_A | 464 | Poly(A) RNA polymerase; nucleotidyl transferase, R | 95.97 | |
| 1nc8_A | 29 | Nucleocapsid protein; HIV-2, RNA recognition, zinc | 95.25 | |
| 2g0c_A | 76 | ATP-dependent RNA helicase DBPA; RNA recognition m | 95.0 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 94.44 | |
| 4eyt_A | 129 | Telomerase associated protein P65; RNA, LA protein | 94.14 | |
| 2ysa_A | 55 | Retinoblastoma-binding protein 6; zinc finger, CCH | 94.12 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 93.84 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 93.79 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 91.9 | |
| 1a6b_B | 40 | Momulv, zinc finger protein NCP10; nucleocapsid pr | 91.75 | |
| 1u6p_A | 56 | GAG polyprotein; MLV, A-minor K-turn, stem loop, b | 91.33 | |
| 1dsq_A | 26 | Nucleic acid binding protein P14; CCHC type zinc f | 90.3 | |
| 3d45_A | 507 | Poly(A)-specific ribonuclease PARN; CAP analogue, | 89.77 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 88.86 | |
| 1nc8_A | 29 | Nucleocapsid protein; HIV-2, RNA recognition, zinc | 88.19 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 86.25 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 85.32 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 85.16 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 83.41 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 81.98 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 80.76 |
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
Probab=99.82 E-value=2.3e-19 Score=173.63 Aligned_cols=77 Identities=31% Similarity=0.584 Sum_probs=71.1
Q ss_pred CCCcEEEEccCCCCCcHHHHHHHHHhcCCeeEEEEe--------CCeEEEEECCHHHHHHHHHhcCCcccCCCceeeeec
Q 021599 8 YGGTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMK--------RDFAFVEFSDPRDADDARYSLNGRDVDGSRIIVEFA 79 (310)
Q Consensus 8 ~~~~~l~V~nL~~~~te~dL~~~F~~~G~V~~v~i~--------~~~afV~F~~~eda~~Ai~~lng~~l~Gr~I~V~~a 79 (310)
...++|||+||++.||+++|++||.+||+|+.|.|+ ++||||+|.+.++|++||+.|||++|+|+.|.|+|+
T Consensus 100 ~~~~~lfV~nL~~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~aFV~F~~~e~A~~Ai~~lng~~i~gr~i~V~~a 179 (437)
T 3pgw_S 100 DAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVE 179 (437)
T ss_pred CCCCEEEEeCCCCCCCHHHHHHHHHHcCCeeEEEeeccCCCCCccceEEEeeccHHHHHHHHHHcCCCEECCEEEEEEEe
Confidence 345899999999999999999999999999999986 459999999999999999999999999999999999
Q ss_pred cCCCC
Q 021599 80 RGGPR 84 (310)
Q Consensus 80 k~~~~ 84 (310)
++...
T Consensus 180 ~~~~~ 184 (437)
T 3pgw_S 180 RGRTV 184 (437)
T ss_pred CCCCC
Confidence 87544
|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* | Back alignment and structure |
|---|
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A | Back alignment and structure |
|---|
| >3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
| >1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A | Back alignment and structure |
|---|
| >1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A | Back alignment and structure |
|---|
| >1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* | Back alignment and structure |
|---|
| >2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A | Back alignment and structure |
|---|
| >1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A | Back alignment and structure |
|---|
| >2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >4eyt_A Telomerase associated protein P65; RNA, LA protein, LARP7, RRM, XRRM, RNA binding protein; 2.50A {Tetrahymena thermophila} PDB: 4erd_A | Back alignment and structure |
|---|
| >2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A | Back alignment and structure |
|---|
| >1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A | Back alignment and structure |
|---|
| >1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 310 | ||||
| d1b7fa2 | 85 | d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil | 1e-16 | |
| d1no8a_ | 78 | d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu | 1e-16 | |
| d1wf2a_ | 98 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 3e-16 | |
| d1cvja1 | 80 | d.58.7.1 (A:11-90) Poly(A)-binding protein {Human | 2e-15 | |
| d1h2vz_ | 93 | d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro | 3e-15 | |
| d1b7fa1 | 82 | d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil | 6e-15 | |
| d2cpfa1 | 85 | d.58.7.1 (A:362-446) Probable RNA-binding protein | 2e-14 | |
| d2cpha1 | 94 | d.58.7.1 (A:454-547) Probable RNA-binding protein | 2e-14 | |
| d2cpja1 | 86 | d.58.7.1 (A:65-150) Non-POU domain-containing octa | 3e-14 | |
| d2u2fa_ | 85 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 2e-13 | |
| d1x4ga1 | 96 | d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s | 2e-13 | |
| d1fxla2 | 85 | d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho | 6e-13 | |
| d1x0fa1 | 75 | d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 | 1e-12 | |
| d2f9da1 | 114 | d.58.7.1 (A:12-125) Pre-mRNA branch site protein p | 1e-12 | |
| d1uawa_ | 77 | d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax | 2e-12 | |
| d1fxla1 | 82 | d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom | 4e-12 | |
| d2dita1 | 99 | d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma | 6e-12 | |
| d2cpda1 | 86 | d.58.7.1 (A:223-308) APOBEC1 stimulating protein { | 1e-11 | |
| d2cqba1 | 89 | d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer | 3e-11 | |
| d1x5ua1 | 93 | d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu | 3e-11 | |
| d1rk8a_ | 88 | d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr | 3e-11 | |
| d2disa1 | 96 | d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { | 3e-11 | |
| d2cqia1 | 90 | d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa | 7e-11 | |
| d1hd0a_ | 75 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 8e-11 | |
| d2msta_ | 75 | d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 | 8e-11 | |
| d2cq3a1 | 93 | d.58.7.1 (A:110-202) RNA-binding protein 9 {Human | 1e-10 | |
| d2cqha1 | 80 | d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is | 1e-10 | |
| d1fjca_ | 96 | d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice | 1e-10 | |
| d1x5ta1 | 83 | d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu | 1e-10 | |
| d1x4aa1 | 95 | d.58.7.1 (A:9-103) Splicing factor, arginine/serin | 3e-10 | |
| d1nu4a_ | 91 | d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo | 4e-10 | |
| d1cvja2 | 89 | d.58.7.1 (A:91-179) Poly(A)-binding protein {Human | 4e-10 | |
| d2ghpa1 | 81 | d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici | 4e-10 | |
| d2cqca1 | 83 | d.58.7.1 (A:109-191) Arginine/serine-rich splicing | 4e-10 | |
| d1weya_ | 104 | d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) | 6e-10 | |
| d2exfa1 | 42 | g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod | 9e-10 | |
| d2exfa1 | 42 | g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod | 0.003 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | d.58.7.3 (A:) 1e-09 | ||
| d2bz2a1 | 79 | d.58.7.1 (A:35-113) Negative elongation factor E, | 2e-09 | |
| d1l3ka1 | 84 | d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN | 2e-09 | |
| d2cq2a1 | 101 | d.58.7.1 (A:25-125) Alkylation repair AlkB homolog | 3e-09 | |
| d1wg1a_ | 88 | d.58.7.1 (A:) Probable RNA-binding protein KIAA157 | 3e-09 | |
| d1wf0a_ | 88 | d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { | 4e-09 | |
| d2cq0a1 | 90 | d.58.7.1 (A:231-320) Eukaryotic translation initia | 4e-09 | |
| d1l3ka2 | 79 | d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 | 8e-09 | |
| d2cqga1 | 90 | d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD | 8e-09 | |
| d2adba1 | 108 | d.58.7.1 (A:177-284) Polypyrimidine tract-binding | 2e-08 | |
| d1whya_ | 97 | d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb | 2e-08 | |
| d1x4ba1 | 103 | d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle | 2e-08 | |
| d2cpza1 | 102 | d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin | 3e-08 | |
| d1x4ea1 | 72 | d.58.7.1 (A:8-79) RNA-binding motif, single-strand | 3e-08 | |
| d1whwa_ | 99 | d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm | 6e-08 | |
| d2cpea1 | 101 | d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma | 8e-08 | |
| d2cq4a1 | 101 | d.58.7.1 (A:132-232) RNA binding protein 23 {Human | 1e-07 | |
| d2cqda1 | 103 | d.58.7.1 (A:1-103) RNA-binding region containing p | 2e-07 | |
| d2adca1 | 109 | d.58.7.1 (A:335-443) Polypyrimidine tract-binding | 4e-07 | |
| d1x5sa1 | 90 | d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote | 5e-07 | |
| d1wi6a1 | 75 | d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding | 5e-07 | |
| d1u6fa1 | 139 | d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa | 9e-07 | |
| d1p1ta_ | 104 | d.58.7.1 (A:) Cleavage stimulation factor, 64 kda | 9e-07 | |
| d2ghpa3 | 86 | d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici | 1e-06 | |
| d1u1qa_ | 183 | d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 | 1e-06 | |
| d1u1qa_ | 183 | d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 | 8e-04 | |
| d1x4ha1 | 98 | d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( | 2e-06 | |
| d1o0pa_ | 104 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 3e-06 | |
| d1x5oa1 | 101 | d.58.7.1 (A:8-108) RNA-binding motif, single-stran | 7e-06 | |
| d2b0ga1 | 83 | d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph | 8e-06 | |
| d1u2fa_ | 90 | d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit | 9e-06 | |
| d2cpxa1 | 102 | d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 | 1e-05 | |
| d2cqpa1 | 86 | d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous | 2e-05 | |
| d1wwha1 | 81 | d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu | 2e-05 | |
| d1x4da1 | 89 | d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ | 5e-05 | |
| d1wi8a_ | 104 | d.58.7.1 (A:) Eukaryotic translation initiation fa | 7e-05 | |
| d1fjeb1 | 91 | d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc | 8e-05 | |
| d1wexa_ | 104 | d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot | 8e-05 | |
| d1wg4a_ | 98 | d.58.7.1 (A:) Splicing factor, arginine/serine-ric | 9e-05 | |
| d2cpia1 | 89 | d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C | 4e-04 | |
| d2cq1a1 | 88 | d.58.7.1 (A:51-138) Polypyrimidine tract-binding p | 4e-04 | |
| d3begb1 | 87 | d.58.7.1 (B:121-207) Splicing factor, arginine/ser | 6e-04 |
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: Sex-lethal protein species: Drosophila melanogaster [TaxId: 7227]
Score = 71.5 bits (175), Expect = 1e-16
Identities = 22/80 (27%), Positives = 33/80 (41%), Gaps = 10/80 (12%)
Query: 10 GTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDM--------KRDFAFVEFSDPRDADDAR 61
T LYV L L+ IF +YG I ++ R AFV ++ +A +A
Sbjct: 6 DTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAI 65
Query: 62 YSLNGRDVDGS--RIIVEFA 79
+LN +G + V A
Sbjct: 66 SALNNVIPEGGSQPLSVRLA 85
|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 310 | |||
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 99.8 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.79 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.78 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.78 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.77 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.77 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 99.77 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.76 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 99.76 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 99.76 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.76 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 99.76 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 99.75 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.75 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 99.75 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 99.75 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 99.75 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 99.74 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 99.74 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 99.74 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.74 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 99.74 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.74 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 99.74 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 99.74 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 99.74 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 99.74 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 99.74 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.74 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 99.74 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 99.74 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 99.74 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 99.73 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 99.73 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 99.73 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 99.73 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 99.73 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 99.73 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 99.72 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 99.72 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.72 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.71 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 99.71 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.7 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 99.7 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 99.7 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 99.7 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 99.7 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 99.7 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 99.7 | |
| d1wf0a_ | 88 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.69 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 99.69 | |
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 99.69 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 99.69 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 99.69 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.69 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 99.69 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 99.68 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 99.68 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 99.67 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.67 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 99.67 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 99.67 | |
| d2disa1 | 96 | Hypothetical protein FLJ20273 {Human (Homo sapiens | 99.66 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 99.66 | |
| d1wexa_ | 104 | Heterogeneous nuclear ribonucleoprotein L-like {Mo | 99.65 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 99.64 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 99.64 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.64 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.63 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 99.62 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 99.62 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 99.61 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.6 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 99.6 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.6 | |
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.59 | |
| d1u2fa_ | 90 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.55 | |
| d1owxa_ | 113 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 99.52 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 99.51 | |
| d2cq2a1 | 101 | Alkylation repair AlkB homolog 8, ALKBH8 {Human (H | 99.49 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.44 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | U2 | 99.39 | |
| d1wwha1 | 81 | Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 | 99.36 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 99.3 | |
| d1o0pa_ | 104 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 99.25 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 99.21 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 98.09 | |
| d1ufwa_ | 95 | Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] | 97.98 | |
| d1uw4a_ | 91 | RNA processing protein UPF3x, RRM domain {Human (H | 97.91 | |
| d2dgxa1 | 73 | Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 | 97.58 | |
| d1nc8a_ | 29 | HIV nucleocapsid {Human immunodeficiency virus typ | 96.49 | |
| d1whva_ | 100 | Poly(A)-specific ribonuclease PARN {Mouse (Mus mus | 95.95 | |
| d1nc8a_ | 29 | HIV nucleocapsid {Human immunodeficiency virus typ | 93.97 | |
| d1dsqa_ | 26 | Nucleic acid binding protein p14 {Mouse mammary tu | 93.51 | |
| d1dsqa_ | 26 | Nucleic acid binding protein p14 {Mouse mammary tu | 86.7 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 85.57 | |
| d1a6bb_ | 40 | Zinc finger protein ncp10 {Moloney murine leukemia | 83.58 |
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: Heterogeneous nuclear ribonucleoproteins C1/C2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80 E-value=6.1e-20 Score=140.15 Aligned_cols=80 Identities=30% Similarity=0.549 Sum_probs=73.3
Q ss_pred CCCCCCCcEEEEccCC-CCCcHHHHHHHHHhcCCeeEEEEeCCeEEEEECCHHHHHHHHHhcCCcccCCCceeeeeccCC
Q 021599 4 YDDRYGGTRLYVGRLA-SRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADDARYSLNGRDVDGSRIIVEFARGG 82 (310)
Q Consensus 4 ~~~~~~~~~l~V~nL~-~~~te~dL~~~F~~~G~V~~v~i~~~~afV~F~~~eda~~Ai~~lng~~l~Gr~I~V~~ak~~ 82 (310)
.+....+++|||+||+ ..+++++|+++|.+||+|+.|.|.++||||+|.+.++|+.||+.|||++|+|+.|.|+|++..
T Consensus 9 ~~~~~~~~~lfV~nL~~~~~~~~~L~~~F~~~G~i~~~~i~rg~aFV~f~~~~~A~~Ai~~lng~~~~g~~l~V~~a~~~ 88 (98)
T d1wf2a_ 9 TDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEP 88 (98)
T ss_dssp CCCSSCCCCEEEEEECTTTCCHHHHHHSSTTSSCEEEEEEETEEEEEEESSHHHHHHHHHTTTTCEETTEECEEEETTSC
T ss_pred CCCCCCCcEEEEeCCCcccCCHHHHHHHHhhcCCEEEEEEeCCeEEEEECCHHHHHHHHHHcCCCEECCEEEEEEECCCC
Confidence 3455677899999997 578899999999999999999999999999999999999999999999999999999999864
Q ss_pred C
Q 021599 83 P 83 (310)
Q Consensus 83 ~ 83 (310)
.
T Consensus 89 ~ 89 (98)
T d1wf2a_ 89 K 89 (98)
T ss_dssp C
T ss_pred C
Confidence 3
|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d1dsqa_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} | Back information, alignment and structure |
|---|