Citrus Sinensis ID: 021601


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MKEQVCVSSSYSFFFPVFVYLISVPVRVSEYDFYCVYTGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIPTGVSPSQRIKMENFRRKHMTYSYCYDQIRYKVPPFECVINPLEAERLKVHDPVTFGGGRRHHGKRHHRSRSSGTKANDV
ccccEEEccccCECcccEEEEEEECcccccEEEEECcccccCECccCEEEEEEEEEEEECccccccEEEEEEECccccccccccEEEEEECccccccccEEEEEEEEcccccccccEEEEcccccccccCEEEEEEcccEEEEEEccCEEEEEEccccccccccccccEEEEEEEccccccccccEEEEccccccEEEEEccEEEEEEECcccccccccccccccccccccccccHHHHHHHHHHccccEEEEccccccccccccccccccHHHHHHcccccccEEcccccccccccccccccccccccc
*******SSSYSFFFPVFVYLISVPVRVSEYDFYCVYTGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSI***VSPSQRIKMENFRRKHMTYSYCYDQIRYKVPPFECVINPLEAERLKVHDPVTF************************
xxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEQVCVSSSYSFFFPVFVYLISVPVRVSEYDFYCVYTGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSKCDITESSKVSIPTGVSPSQRIKMENFRRKHMTYSYCYDQIRYKVPPFECVINPLEAERLKVHDPVTFGGGRRHHGKRHHRSRSSGTKANDV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable xyloglucan endotransglucosylase/hydrolase protein 28 Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.probableQ38909
Probable xyloglucan endotransglucosylase/hydrolase protein 27 Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.probableQ8LDS2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2UWA, chain A
Confidence level:very confident
Coverage over the Query: 27-268
View the alignment between query and template
View the model in PyMOL