Citrus Sinensis ID: 021613

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MAVATGSSSCCKLAKPCAFTTSNSSQSPFKLKKFTASPAKSTSIRCTIARDPVVPMEAKKESDPAPWQRPDVFGRFGRFGGKFVPETLMYALSELESALHKLADDRDFQEELSGILRDYVGRETPLYFAERLTEHYRRPNGGGPHIYLKREDLNHTGAHKINNAVGQALLAKRLGKTRIIAETGAGQHGVATATVCARFGLQCIVYMGAQDMERQALNVFRMRLLGAEVRAVHSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHATSIGEMGWETRCADCMRWWWFKCHGSLPRIC
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHccccEEEccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHcccccEEEECcccccccccHHHccccccccccccHHHHcccHHHHHHHHHHccccccc
********************************************************************RPDVFGRFGRFGGKFVPETLMYALSELESALHKLADDRDFQEELSGILRDYVGRETPLYFAERLTEHYRRPNGGGPHIYLKREDLNHTGAHKINNAVGQALLAKRLGKTRIIAETGAGQHGVATATVCARFGLQCIVYMGAQDMERQALNVFRMRLLGAEVRAVHSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHATSIGEMGWETRCADCMRWWWFKCHGSLPRI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVATGSSSCCKLAKPCAFTTSNSSQSPFKLKKFTASPAKSTSIRCTIARDPVVPMEAKKESDPAPWQRPDVFGRFGRFGGKFVPETLMYAxxxxxxxxxxxxxxxxxxxxxSGILRDYVGRETPLYFAERLTEHYRRPNGGGPHIYLKREDLNHTGAHKINNAVGQALLAKRLGKTRIIAETGAGQHGVATATVCARFGLQCIVYMGAQDMERQALNVFRMRLLGAEVRAVHSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHATSIGEMGWETRCADCMRWWWFKCHGSLPRIC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tryptophan synthase beta chain 2 The beta subunit is responsible for the synthesis of L-tryptophan from indole and L-serine.probableQ8YQM6
Tryptophan synthase beta chain The beta subunit is responsible for the synthesis of L-tryptophan from indole and L-serine.probableQ3AGY2
Tryptophan synthase beta chain The beta subunit is responsible for the synthesis of L-tryptophan from indole and L-serine.probableA9BD24

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.2.-.-Carbon-oxygen lyases.probable
4.2.1.-Hydro-lyases.probable
4.2.1.20Tryptophan synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X1Q, chain A
Confidence level:very confident
Coverage over the Query: 68-308
View the alignment between query and template
View the model in PyMOL