Citrus Sinensis ID: 021623

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MAKSSGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL
ccccccccHHHHccccccccCEEECcHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEEEEEcccccccEEEEEEEEEEEEEcccEEEEEEEEEEEEcccccEEEEEEEcEEEEcccccccccccccccccccccccccccccccccEEEEEECcccccEEEEEccccccccccHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccccccEEEEEEEEccEEEEEEEEcccccEEEEEEEEEEEccccc
*****GI*PELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGF******************VVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKSSGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Enoyl-CoA hydratase 2, peroxisomal Bidirectional monofunctional enoyl-CoA hydratase 2 involved in the degradation of even cis-unsaturated fatty acids. Devoid of 3-hydroxyacyl-CoA dehydrogenase activity.probableQ8VYI3
Probable enoyl-CoA hydratase 2 probableQ54XZ0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S9C, chain A
Confidence level:very confident
Coverage over the Query: 12-80,94-155,167-305
View the alignment between query and template
View the model in PyMOL