Citrus Sinensis ID: 021623

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MAKSSGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL
ccccccccHHHHccccccccEEEEEcHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccEEEEEEEEEEEEEcccEEEEEEEEEEEEcccccEEEEEEEcEEEEcccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccccccEEEEEEEEccEEEEEEEEcccccEEEEEEEEEEEccccc
ccccccccHHHHHHcccccccEEEccHHHHHHHHccccccccccccHHHcHEEEEcccccccEEcccEEEEcccccccccccccccccccHHHHHcccEEEEEEccccccEEEEEEEEEEEEEccccEEEEEEEEEEEEcccccEEEEEEEEEEEEcccccccccccccccccccccccccccccccccEEEEEcccHccEEEEEHHccccHHHHcHHHHccccccccEccHHHHHHHHHHHHHHHHccccHHHHHHEEEEEccccccccEEEEEEEccccEEEEEEEEEEcccEEEEEEEEEccccccc
makssginpelllsqklpeqktftyteRDAAIYALGvgacgrdavdadelkyvYHENGQQFIQVLPTFSALfsfelepsgaidlpglqhdprlllhgqqymelykpfpssasiRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFlrgaggfsnssqpfsyskyqtipvsvvkipksqpfavfedytqpsQALVYRLsgdynplhsdpmvakaagfsrpilhglCTMGFAVRAIIKFIcrgdpnmvKNIFSRFLlhvypgetlVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL
makssginpelllsqklpeqKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKernrsalsgfvdvhrlassl
MAKSSGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL
********************KTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDV*******
*****GI*PELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGG***********************PKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRL****
MAKSSGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL
*****GINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGF******************VVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKSSGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query310 2.2.26 [Sep-21-2011]
Q8VYI3309 Enoyl-CoA hydratase 2, pe yes no 0.993 0.996 0.672 1e-122
P51659 736 Peroxisomal multifunction yes no 0.887 0.373 0.414 4e-54
Q01373894 Peroxisomal hydratase-deh N/A no 0.838 0.290 0.420 4e-53
P51660 735 Peroxisomal multifunction yes no 0.890 0.375 0.392 3e-47
P97852 735 Peroxisomal multifunction yes no 0.893 0.376 0.394 6e-47
Q9VXJ0598 Peroxisomal multifunction yes no 0.932 0.483 0.359 5e-45
Q54XZ0294 Probable enoyl-CoA hydrat yes no 0.845 0.891 0.365 7e-39
Q02207900 Peroxisomal hydratase-deh yes no 0.854 0.294 0.356 3e-32
P22414906 Peroxisomal hydratase-deh N/A no 0.829 0.283 0.328 8e-29
Q9UUG0 2073 Fatty acid synthase subun yes no 0.367 0.054 0.289 0.0003
>sp|Q8VYI3|ECH2_ARATH Enoyl-CoA hydratase 2, peroxisomal OS=Arabidopsis thaliana GN=ECH2 PE=1 SV=1 Back     alignment and function desciption
 Score =  437 bits (1124), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 209/311 (67%), Positives = 249/311 (80%), Gaps = 3/311 (0%)

Query: 1   MAKS-SGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQ 59
           MA S S  N +LLL+ KLPE + +TY ERD AIYALG+GACG+DAVD+DELK+VYH NGQ
Sbjct: 1   MATSDSEFNSDLLLAHKLPETR-YTYNERDVAIYALGIGACGQDAVDSDELKFVYHRNGQ 59

Query: 60  QFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACI 119
             IQVLPTF++LF+      G +DLPG ++DP LLLHGQQY+E+Y+P PS AS+ N+  +
Sbjct: 60  DLIQVLPTFASLFTLGSLTEG-LDLPGFKYDPSLLLHGQQYIEIYRPLPSKASLINKVSL 118

Query: 120 AGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVS 179
           AGL DKGKAAILE+ET+SY   SGELLCMNR T FLRGAGGFSNSSQPFSY  Y +    
Sbjct: 119 AGLQDKGKAAILELETRSYEEGSGELLCMNRTTVFLRGAGGFSNSSQPFSYKNYPSNQGL 178

Query: 180 VVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFA 239
            VKIP+ QP  V E+ TQPSQAL+YRLSGDYNPLHSDP  AK AGF RPILHGLCT+GFA
Sbjct: 179 AVKIPQRQPLTVCEERTQPSQALLYRLSGDYNPLHSDPEFAKLAGFPRPILHGLCTLGFA 238

Query: 240 VRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSG 299
           ++AIIK +C+GDP  VK I  RFL  V+PGETL+TEMWL+GLRVIYQ KVKERN++ L+G
Sbjct: 239 IKAIIKCVCKGDPTAVKTISGRFLTTVFPGETLITEMWLEGLRVIYQTKVKERNKTVLAG 298

Query: 300 FVDVHRLASSL 310
           +VD+  L+SSL
Sbjct: 299 YVDIRGLSSSL 309
Bidirectional monofunctional enoyl-CoA hydratase 2 involved in the degradation of even cis-unsaturated fatty acids. Devoid of 3-hydroxyacyl-CoA dehydrogenase activity.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 1EC: 9
>sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 Back     alignment and function description
>sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 Back     alignment and function description
>sp|P51660|DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3 Back     alignment and function description
>sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 Back     alignment and function description
>sp|Q9VXJ0|DHB4_DROME Peroxisomal multifunctional enzyme type 2 OS=Drosophila melanogaster GN=Mfe2 PE=1 SV=1 Back     alignment and function description
>sp|Q54XZ0|MFEB_DICDI Probable enoyl-CoA hydratase 2 OS=Dictyostelium discoideum GN=mfeB PE=2 SV=1 Back     alignment and function description
>sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=1 SV=1 Back     alignment and function description
>sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 Back     alignment and function description
>sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
224085982309 predicted protein [Populus trichocarpa] 0.996 1.0 0.738 1e-135
255539120309 estradiol 17 beta-dehydrogenase, putativ 0.990 0.993 0.737 1e-133
225459804306 PREDICTED: enoyl-CoA hydratase 2, peroxi 0.987 1.0 0.722 1e-130
388493320306 unknown [Lotus japonicus] 0.987 1.0 0.706 1e-128
363807872308 uncharacterized protein LOC100780490 [Gl 0.993 1.0 0.706 1e-124
388520855308 unknown [Medicago truncatula] 0.993 1.0 0.696 1e-124
356508947308 PREDICTED: enoyl-CoA hydratase 2, peroxi 0.993 1.0 0.706 1e-124
449450474309 PREDICTED: enoyl-CoA hydratase 2, peroxi 0.983 0.987 0.697 1e-123
297842361309 hypothetical protein ARALYDRAFT_895493 [ 0.980 0.983 0.673 1e-120
22330656309 enoyl-CoA hydratase 2 [Arabidopsis thali 0.993 0.996 0.672 1e-120
>gi|224085982|ref|XP_002307764.1| predicted protein [Populus trichocarpa] gi|222857213|gb|EEE94760.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  488 bits (1257), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 229/310 (73%), Positives = 267/310 (86%), Gaps = 1/310 (0%)

Query: 1   MAKSSGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQ 60
           MA +S  + +L+L+ K PE  TFTYTERDAA+YALGVGACGR+A+D+DELKYVYHENGQQ
Sbjct: 1   MADNSRFDHDLVLAHKFPE-TTFTYTERDAAVYALGVGACGRNAIDSDELKYVYHENGQQ 59

Query: 61  FIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIA 120
           F+QVLPTF+ALFS     +G+IDLPGLQ+DPRLLLHGQQY+++YKPFPSSAS+ N+  +A
Sbjct: 60  FVQVLPTFAALFSLGSLTNGSIDLPGLQYDPRLLLHGQQYIQIYKPFPSSASLINKVSLA 119

Query: 121 GLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSV 180
           GLHDKGKAAILE+ETKSY  +SGELLCMNR T +LRGAGGFSNSS P+SYS Y     + 
Sbjct: 120 GLHDKGKAAILELETKSYEKQSGELLCMNRSTIYLRGAGGFSNSSHPYSYSNYPVNQAAA 179

Query: 181 VKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAV 240
            KIPKSQPFAVFED TQPSQAL+YRLSGDYNPLHSDPM+A+ AGFSRPILHGLC++GFAV
Sbjct: 180 PKIPKSQPFAVFEDCTQPSQALLYRLSGDYNPLHSDPMIAEVAGFSRPILHGLCSLGFAV 239

Query: 241 RAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGF 300
           RA+IK ICRGD N++K I  RFLLHVYPGETL+TEMWL+G RVIYQ KVKERNR+ LSGF
Sbjct: 240 RAVIKCICRGDANIIKTISGRFLLHVYPGETLITEMWLEGSRVIYQAKVKERNRAVLSGF 299

Query: 301 VDVHRLASSL 310
           VD+  +  SL
Sbjct: 300 VDLRHVTPSL 309

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255539120|ref|XP_002510625.1| estradiol 17 beta-dehydrogenase, putative [Ricinus communis] gi|223551326|gb|EEF52812.1| estradiol 17 beta-dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225459804|ref|XP_002285911.1| PREDICTED: enoyl-CoA hydratase 2, peroxisomal [Vitis vinifera] gi|302141689|emb|CBI18892.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388493320|gb|AFK34726.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|363807872|ref|NP_001242700.1| uncharacterized protein LOC100780490 [Glycine max] gi|255642179|gb|ACU21354.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388520855|gb|AFK48489.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356508947|ref|XP_003523214.1| PREDICTED: enoyl-CoA hydratase 2, peroxisomal-like [Glycine max] Back     alignment and taxonomy information
>gi|449450474|ref|XP_004142987.1| PREDICTED: enoyl-CoA hydratase 2, peroxisomal-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297842361|ref|XP_002889062.1| hypothetical protein ARALYDRAFT_895493 [Arabidopsis lyrata subsp. lyrata] gi|297334903|gb|EFH65321.1| hypothetical protein ARALYDRAFT_895493 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22330656|ref|NP_177742.2| enoyl-CoA hydratase 2 [Arabidopsis thaliana] gi|75161483|sp|Q8VYI3.1|ECH2_ARATH RecName: Full=Enoyl-CoA hydratase 2, peroxisomal gi|17979531|gb|AAL50100.1| At1g76150/T23E18_38 [Arabidopsis thaliana] gi|20147245|gb|AAM10336.1| At1g76150/T23E18_38 [Arabidopsis thaliana] gi|332197682|gb|AEE35803.1| enoyl-CoA hydratase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
TAIR|locus:2199767309 ECH2 "enoyl-CoA hydratase 2" [ 0.993 0.996 0.672 6.8e-111
UNIPROTKB|E1BW32624 HSD17B4 "Uncharacterized prote 0.919 0.456 0.408 4.9e-53
UNIPROTKB|F1NKH9678 HSD17B4 "Uncharacterized prote 0.919 0.420 0.408 4.9e-53
UNIPROTKB|E7EPL9 474 HSD17B4 "(3R)-hydroxyacyl-CoA 0.890 0.582 0.412 2.1e-52
UNIPROTKB|E7ET17 599 HSD17B4 "(3R)-hydroxyacyl-CoA 0.890 0.460 0.412 2.1e-52
UNIPROTKB|E7EWE5 712 HSD17B4 "(3R)-hydroxyacyl-CoA 0.890 0.387 0.412 2.1e-52
UNIPROTKB|G5E9S2 596 HSD17B4 "Hydroxysteroid (17-be 0.890 0.463 0.412 2.1e-52
UNIPROTKB|P51659 736 HSD17B4 "Peroxisomal multifunc 0.890 0.375 0.412 2.1e-52
MGI|MGI:105089 735 Hsd17b4 "hydroxysteroid (17-be 0.890 0.375 0.406 1.1e-50
RGD|621806 735 Hsd17b4 "hydroxysteroid (17-be 0.893 0.376 0.408 1.1e-50
TAIR|locus:2199767 ECH2 "enoyl-CoA hydratase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1095 (390.5 bits), Expect = 6.8e-111, P = 6.8e-111
 Identities = 209/311 (67%), Positives = 249/311 (80%)

Query:     1 MAKS-SGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQ 59
             MA S S  N +LLL+ KLPE + +TY ERD AIYALG+GACG+DAVD+DELK+VYH NGQ
Sbjct:     1 MATSDSEFNSDLLLAHKLPETR-YTYNERDVAIYALGIGACGQDAVDSDELKFVYHRNGQ 59

Query:    60 QFIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACI 119
               IQVLPTF++LF+      G +DLPG ++DP LLLHGQQY+E+Y+P PS AS+ N+  +
Sbjct:    60 DLIQVLPTFASLFTLGSLTEG-LDLPGFKYDPSLLLHGQQYIEIYRPLPSKASLINKVSL 118

Query:   120 AGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVS 179
             AGL DKGKAAILE+ET+SY   SGELLCMNR T FLRGAGGFSNSSQPFSY  Y +    
Sbjct:   119 AGLQDKGKAAILELETRSYEEGSGELLCMNRTTVFLRGAGGFSNSSQPFSYKNYPSNQGL 178

Query:   180 VVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFA 239
              VKIP+ QP  V E+ TQPSQAL+YRLSGDYNPLHSDP  AK AGF RPILHGLCT+GFA
Sbjct:   179 AVKIPQRQPLTVCEERTQPSQALLYRLSGDYNPLHSDPEFAKLAGFPRPILHGLCTLGFA 238

Query:   240 VRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSG 299
             ++AIIK +C+GDP  VK I  RFL  V+PGETL+TEMWL+GLRVIYQ KVKERN++ L+G
Sbjct:   239 IKAIIKCVCKGDPTAVKTISGRFLTTVFPGETLITEMWLEGLRVIYQTKVKERNKTVLAG 298

Query:   300 FVDVHRLASSL 310
             +VD+  L+SSL
Sbjct:   299 YVDIRGLSSSL 309
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0005777 "peroxisome" evidence=IDA
GO:0033542 "fatty acid beta-oxidation, unsaturated, even number" evidence=IMP
GO:0080023 "3R-hydroxyacyl-CoA dehydratase activity" evidence=IGI;IDA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0007031 "peroxisome organization" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0010260 "organ senescence" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
UNIPROTKB|E1BW32 HSD17B4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKH9 HSD17B4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E7EPL9 HSD17B4 "(3R)-hydroxyacyl-CoA dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ET17 HSD17B4 "(3R)-hydroxyacyl-CoA dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EWE5 HSD17B4 "(3R)-hydroxyacyl-CoA dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G5E9S2 HSD17B4 "Hydroxysteroid (17-beta) dehydrogenase 4, isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P51659 HSD17B4 "Peroxisomal multifunctional enzyme type 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:105089 Hsd17b4 "hydroxysteroid (17-beta) dehydrogenase 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621806 Hsd17b4 "hydroxysteroid (17-beta) dehydrogenase 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VYI3ECH2_ARATH4, ., 2, ., 1, ., 1, 1, 90.67200.99350.9967yesno
Q54XZ0MFEB_DICDI4, ., 2, ., 1, ., 1, 1, 90.36580.84510.8911yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0002075501
enoyl-CoA hydratase (EC-4.2.1.17) (309 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pg.C_scaffold_20516000001
Predicted protein (278 aa)
•••• •• 0.832
eugene3.32360002
annotation not avaliable (164 aa)
• •     0.506
eugene3.33700002
Predicted protein (418 aa)
•       0.503
eugene3.31020003
annotation not avaliable (332 aa)
• •  •  0.473
eugene3.150520001
Predicted protein (286 aa)
•       0.404

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
PLN02864310 PLN02864, PLN02864, enoyl-CoA hydratase 0.0
cd03448122 cd03448, HDE_HSD, HDE_HSD The R-hydratase-like hot 6e-57
cd03441127 cd03441, R_hydratase_like, (R)-hydratase [(R)-spec 4e-23
pfam01575123 pfam01575, MaoC_dehydratas, MaoC like domain 4e-22
COG2030159 COG2030, MaoC, Acyl dehydratase [Lipid metabolism] 3e-15
cd03447126 cd03447, FAS_MaoC, FAS_MaoC, the MaoC-like hot dog 2e-09
cd03453127 cd03453, SAV4209_like, SAV4209_like 8e-09
PRK13693142 PRK13693, PRK13693, (3R)-hydroxyacyl-ACP dehydrata 5e-07
cd03449128 cd03449, R_hydratase, (R)-hydratase [(R)-specific 1e-06
cd03455123 cd03455, SAV4209, SAV4209 is a Streptomyces avermi 2e-06
pfam13452132 pfam13452, zf-MaoC, Metal-binding domain of MaoC d 2e-06
cd03446140 cd03446, MaoC_like, MoaC_like Similar to the MaoC 6e-06
>gnl|CDD|178455 PLN02864, PLN02864, enoyl-CoA hydratase Back     alignment and domain information 
 Score =  556 bits (1435), Expect = 0.0
 Identities = 229/310 (73%), Positives = 258/310 (83%), Gaps = 1/310 (0%)

Query: 1   MAKSSGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQ 60
           M   S  +P+L+L+ K PE  T++YTERD A+YALGVGACGRDAVD DELKYVYH +GQQ
Sbjct: 2   MPPISPFDPDLVLAHKFPEV-TYSYTERDVALYALGVGACGRDAVDEDELKYVYHRDGQQ 60

Query: 61  FIQVLPTFSALFSFELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIA 120
           FI+VLPTF++LF+        +DLPGL +DP LLLHGQQY+E+YKP PSSAS+RN+  IA
Sbjct: 61  FIKVLPTFASLFNLGSLDGFGLDLPGLNYDPSLLLHGQQYIEIYKPIPSSASVRNKVSIA 120

Query: 121 GLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSV 180
           GLHDKGKAAILE+ET SY  +SGELLCMNR T FLRGAGGFSNSSQPFSYS Y T  VS 
Sbjct: 121 GLHDKGKAAILELETLSYEKDSGELLCMNRSTIFLRGAGGFSNSSQPFSYSNYPTNQVSA 180

Query: 181 VKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAV 240
           VKIPKSQP AVFED TQPSQAL+YRLSGDYNPLHSDPM AK AGF+RPILHGLCT+GFAV
Sbjct: 181 VKIPKSQPDAVFEDQTQPSQALLYRLSGDYNPLHSDPMFAKVAGFTRPILHGLCTLGFAV 240

Query: 241 RAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGF 300
           RA+IK  C GDP  VK I  RFLLHVYPGETLVTEMWL+GLRVIYQ KVKERN++ LSG+
Sbjct: 241 RAVIKCFCNGDPTAVKTISGRFLLHVYPGETLVTEMWLEGLRVIYQTKVKERNKAVLSGY 300

Query: 301 VDVHRLASSL 310
           VD+  L SSL
Sbjct: 301 VDLRHLTSSL 310

Length = 310
>gnl|CDD|239532 cd03448, HDE_HSD, HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins Back     alignment and domain information
>gnl|CDD|239525 cd03441, R_hydratase_like, (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>gnl|CDD|216580 pfam01575, MaoC_dehydratas, MaoC like domain Back     alignment and domain information
>gnl|CDD|224941 COG2030, MaoC, Acyl dehydratase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|239531 cd03447, FAS_MaoC, FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>gnl|CDD|239537 cd03453, SAV4209_like, SAV4209_like Back     alignment and domain information
>gnl|CDD|184249 PRK13693, PRK13693, (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional Back     alignment and domain information
>gnl|CDD|239533 cd03449, R_hydratase, (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>gnl|CDD|239539 cd03455, SAV4209, SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>gnl|CDD|222140 pfam13452, zf-MaoC, Metal-binding domain of MaoC dehydratase Back     alignment and domain information
>gnl|CDD|239530 cd03446, MaoC_like, MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 310
PLN02864310 enoyl-CoA hydratase 100.0
KOG1206272 consensus Peroxisomal multifunctional beta-oxidati 100.0
cd03448122 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold 99.94
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t 99.94
PF13452132 MaoC_dehydrat_N: N-terminal half of MaoC dehydrata 99.93
PRK13691166 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro 99.92
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to 99.9
cd03455123 SAV4209 SAV4209 is a Streptomyces avermitilis prot 99.9
PRK13692159 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro 99.89
COG3777273 Uncharacterized conserved protein [Function unknow 99.88
COG2030159 MaoC Acyl dehydratase [Lipid metabolism] 99.87
cd03452142 MaoC_C MaoC_C The C-terminal hot dog fold of the M 99.86
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA 99.85
PRK13693142 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Pro 99.85
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl 99.85
cd03451146 FkbR2 FkbR2 is a Streptomyces hygroscopicus protei 99.84
PF01575122 MaoC_dehydratas: MaoC like domain; InterPro: IPR00 99.83
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine 99.82
PRK08190 466 bifunctional enoyl-CoA hydratase/phosphate acetylt 99.81
cd03454140 YdeM YdeM is a Bacillus subtilis protein that belo 99.79
cd03450149 NodN NodN (nodulation factor N) contains a single 99.78
PRK13691166 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro 99.77
PRK13692159 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro 99.74
cd03450149 NodN NodN (nodulation factor N) contains a single 99.71
cd03452142 MaoC_C MaoC_C The C-terminal hot dog fold of the M 99.7
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine 99.68
TIGR02278663 PaaN-DH phenylacetic acid degradation protein paaN 99.68
cd03454140 YdeM YdeM is a Bacillus subtilis protein that belo 99.66
PRK11563675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 99.66
cd03451146 FkbR2 FkbR2 is a Streptomyces hygroscopicus protei 99.65
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to 99.62
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA 99.57
cd03455123 SAV4209 SAV4209 is a Streptomyces avermitilis prot 99.54
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl 99.5
PRK08190 466 bifunctional enoyl-CoA hydratase/phosphate acetylt 99.44
TIGR02278663 PaaN-DH phenylacetic acid degradation protein paaN 99.35
PRK11563675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 99.28
COG2030159 MaoC Acyl dehydratase [Lipid metabolism] 99.26
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t 99.24
PF13452132 MaoC_dehydrat_N: N-terminal half of MaoC dehydrata 99.03
PRK13693142 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Pro 98.97
PF01575122 MaoC_dehydratas: MaoC like domain; InterPro: IPR00 98.84
cd03448122 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold 98.46
PRK04424185 fatty acid biosynthesis transcriptional regulator; 98.31
PRK00006147 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review 98.3
cd01288131 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier 98.29
PLN02864310 enoyl-CoA hydratase 98.19
PRK13188464 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl 98.01
TIGR01750140 fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd 97.67
cd00493131 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr 97.51
TIGR02286114 PaaD phenylacetic acid degradation protein PaaD. S 97.47
cd03440100 hot_dog The hotdog fold was initially identified i 97.35
PF0306179 4HBT: Thioesterase superfamily; InterPro: IPR00668 96.83
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameri 96.58
PRK00006147 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review 96.57
cd01289138 FabA_like Domain of unknown function, appears to b 96.56
cd0344594 Thioesterase_II_repeat2 Thioesterase II (TEII) is 96.43
cd00586110 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat 96.43
TIGR02286114 PaaD phenylacetic acid degradation protein PaaD. S 96.39
PF07977138 FabA: FabA-like domain; InterPro: IPR013114 Fatty 96.28
cd03440100 hot_dog The hotdog fold was initially identified i 96.1
TIGR01749169 fabA beta-hydroxyacyl-[acyl carrier protein] dehyd 96.03
cd00586110 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat 96.02
PRK10800130 acyl-CoA thioesterase YbgC; Provisional 95.96
TIGR00369117 unchar_dom_1 uncharacterized domain 1. Most protei 95.92
PRK04424185 fatty acid biosynthesis transcriptional regulator; 95.8
PRK05174172 3-hydroxydecanoyl-(acyl carrier protein) dehydrata 95.75
PF13622 255 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 95.56
COG0764147 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl ca 95.55
PF0306179 4HBT: Thioesterase superfamily; InterPro: IPR00668 95.51
cd03442123 BFIT_BACH Brown fat-inducible thioesterase (BFIT). 95.36
cd01288131 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier 95.35
TIGR01750140 fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd 95.33
TIGR00369117 unchar_dom_1 uncharacterized domain 1. Most protei 95.29
PRK10800130 acyl-CoA thioesterase YbgC; Provisional 95.2
COG2050141 PaaI HGG motif-containing thioesterase, possibly i 95.11
PRK11688154 hypothetical protein; Provisional 94.98
PRK11688154 hypothetical protein; Provisional 94.96
COG5496130 Predicted thioesterase [General function predictio 94.81
KOG1206272 consensus Peroxisomal multifunctional beta-oxidati 94.75
cd0055699 Thioesterase_II Thioesterase II (TEII) is thought 94.7
PF13279121 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 94.65
COG0824137 FcbC Predicted thioesterase [General function pred 94.62
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameri 94.62
TIGR00189 271 tesB acyl-CoA thioesterase II. Subunit: homotetram 94.58
PRK10254137 thioesterase; Provisional 94.5
cd01287150 FabA FabA, beta-hydroxydecanoyl-acyl carrier prote 94.46
PLN02322154 acyl-CoA thioesterase 94.44
PF07977138 FabA: FabA-like domain; InterPro: IPR013114 Fatty 94.44
cd01287150 FabA FabA, beta-hydroxydecanoyl-acyl carrier prote 94.36
cd03442123 BFIT_BACH Brown fat-inducible thioesterase (BFIT). 94.34
PRK10293136 acyl-CoA esterase; Provisional 94.27
TIGR02799126 thio_ybgC tol-pal system-associated acyl-CoA thioe 94.25
TIGR02799126 thio_ybgC tol-pal system-associated acyl-CoA thioe 93.97
COG0824137 FcbC Predicted thioesterase [General function pred 93.88
PLN02647437 acyl-CoA thioesterase 93.86
COG2050141 PaaI HGG motif-containing thioesterase, possibly i 93.45
PRK13188464 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl 93.33
PRK10526 286 acyl-CoA thioesterase II; Provisional 93.19
PRK10254137 thioesterase; Provisional 93.14
PF01643261 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 93.01
PLN02370419 acyl-ACP thioesterase 92.97
COG1607157 Acyl-CoA hydrolase [Lipid metabolism] 92.88
PF12119 218 DUF3581: Protein of unknown function (DUF3581); In 92.81
cd00493131 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr 92.78
TIGR00051117 acyl-CoA thioester hydrolase, YbgC/YbaW family. Th 92.47
PRK10293136 acyl-CoA esterase; Provisional 92.16
cd0055699 Thioesterase_II Thioesterase II (TEII) is thought 92.15
COG1946289 TesB Acyl-CoA thioesterase [Lipid metabolism] 91.61
PRK10694133 acyl-CoA esterase; Provisional 91.43
PF13279121 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 91.34
PLN02322154 acyl-CoA thioesterase 90.83
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 90.81
TIGR00051117 acyl-CoA thioester hydrolase, YbgC/YbaW family. Th 90.81
TIGR02447138 yiiD_Cterm thioesterase domain, putative. This fam 89.9
COG1607157 Acyl-CoA hydrolase [Lipid metabolism] 88.68
KOG3328148 consensus HGG motif-containing thioesterase [Gener 88.1
PF02551131 Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IP 87.24
PRK10694133 acyl-CoA esterase; Provisional 86.9
PRK05174172 3-hydroxydecanoyl-(acyl carrier protein) dehydrata 86.8
TIGR00189271 tesB acyl-CoA thioesterase II. Subunit: homotetram 86.08
PRK10526286 acyl-CoA thioesterase II; Provisional 85.25
cd01289138 FabA_like Domain of unknown function, appears to b 85.07
TIGR02447138 yiiD_Cterm thioesterase domain, putative. This fam 84.98
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 84.45
PLN02868 413 acyl-CoA thioesterase family protein 83.99
COG0764147 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl ca 83.95
TIGR01749169 fabA beta-hydroxyacyl-[acyl carrier protein] dehyd 83.8
cd03444104 Thioesterase_II_repeat1 Thioesterase II (TEII) is 83.21
PF14539132 DUF4442: Domain of unknown function (DUF4442); PDB 80.09
>PLN02864 enoyl-CoA hydratase Back     alignment and domain information 
Probab=100.00  E-value=2e-62  Score=447.11  Aligned_cols=309  Identities=74%  Similarity=1.194  Sum_probs=267.7

Q ss_pred             CCCcCCCChhhhcCCCCCCcceEEechhHHHHHHhhcCCCCCCCCCcccccceeeccCcCCccccceeeeccccCCCCCC
Q 021623            1 MAKSSGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPSG   80 (310)
Q Consensus         1 ~~~~~~~d~~~~vG~~~~~~~~~~vt~~~i~~yA~avG~~~~~Pl~~d~~~~~~~~~g~~~~~apPtf~~~l~~~~~~~~   80 (310)
                      |--..++|.++++|+++++ .++.|+++|+++||++||+++.+|+..++++|+||..||++++|||||++++.+......
T Consensus         2 ~~~~~~~~~~~~~g~~~p~-~~~~~~~~d~~lyAl~vG~~~~~~~d~~~l~~~ye~~g~~~~~a~PTf~~vl~~~~~~~~   80 (310)
T PLN02864          2 MPPISPFDPDLVLAHKFPE-VTYSYTERDVALYALGVGACGRDAVDEDELKYVYHRDGQQFIKVLPTFASLFNLGSLDGF   80 (310)
T ss_pred             CCCCCCCCHHHHhCCcCCC-eeEEECHHHHHHHHHhcCCCCCCCCChHHhhhhhccccCCCcccCCceeeeccccCcccc
Confidence            5556789999999999999 899999999999999999533444556789999997789999999999999986541111


Q ss_pred             CCCCCCCCCCCceeeeeeEEEEEeccCCCCcEEEEEEEEEEEEEcCCeEEEEEEEEEEECCCCcEEEEEEEEEEEeccCC
Q 021623           81 AIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGG  160 (310)
Q Consensus        81 ~~~~~~~~~~~~~~vH~~~~~~~~~Pl~~gd~l~~~~~v~~v~~k~~G~~v~~~~~~~~~~~Ge~v~~~~~t~~~rg~~~  160 (310)
                      .+..|+++||+.++||++|+|++||||+++++|+++++|.++++||+|.+++++.++++.++|++||++++++++|+.++
T Consensus        81 ~~~~p~~~~d~~~lVHgeq~i~~~rPlp~~~~l~~~~~v~~v~dkG~ga~v~~~~~~~d~~~Ge~v~t~~st~~~Rg~gg  160 (310)
T PLN02864         81 GLDLPGLNYDPSLLLHGQQYIEIYKPIPSSASVRNKVSIAGLHDKGKAAILELETLSYEKDSGELLCMNRSTIFLRGAGG  160 (310)
T ss_pred             cccCCCCCCChhheeeccceEEEECCCCCCCEEEEEEEEEEEEeCCCcEEEEEEEEEEeCCCCcEEEEEEEEEEEeCCCC
Confidence            13568889999999999999999999999999999999999999999998999988765479999999999999999998


Q ss_pred             CCCCCCCCCCCcCCCCCcccCCCCCCCCceEeeecCHHHHHHHHHHhCCCCCCCCCHHHHhhCCCCCceechHHHHHHHH
Q 021623          161 FSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAV  240 (310)
Q Consensus       161 ~~~~~~p~~~~~~~~~~~~~~~~p~~~p~~~~~~~~~~d~~~~~~~sgD~npiH~d~~~A~~~gf~~~i~hG~~~~~~~~  240 (310)
                      +++++.|......+.......+.|++.|+.+.+..++.++.+||++|||+||||+|+++|+..||+++|+||||+++++.
T Consensus       161 ~g~~~~~~~~~~~~~~~~~~~~~p~~~pd~~~~~~t~~~~~~~a~lSGD~NPiH~d~~~A~~~gf~~~IaHGm~t~g~~~  240 (310)
T PLN02864        161 FSNSSQPFSYSNYPTNQVSAVKIPKSQPDAVFEDQTQPSQALLYRLSGDYNPLHSDPMFAKVAGFTRPILHGLCTLGFAV  240 (310)
T ss_pred             CCCCCCCccccccccccccccCCCCCCCCeEEeeccChhHHHHHHhhCCCCcccCCHHHHhhCCCCCceeccHHHHHHHH
Confidence            87665543211222222234567888899999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhcCCCceEEEEEEEECcCCCCCCEEEEEEEEECcEEEEEEEEecCCcEEEEEEEEEEeccCCC
Q 021623          241 RAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALSGFVDVHRLASSL  310 (310)
Q Consensus       241 ~~~~~~~~~g~~~~~~~~~~rf~~Pv~~gd~l~~~~~~~~~~v~~~~~~~~~g~~vl~g~a~v~~p~~~~  310 (310)
                      +++.++.+++++..+.++++||.+||++||+|++++|..++.+.|++++|++|++|++|.++++.+.+||
T Consensus       241 ~~~~~~~~~~~~~~~~~~~~rF~~PV~pGdtl~~~~~~~~~~v~~~~~~~~~g~~vl~G~a~~~~~~~~~  310 (310)
T PLN02864        241 RAVIKCFCNGDPTAVKTISGRFLLHVYPGETLVTEMWLEGLRVIYQTKVKERNKAVLSGYVDLRHLTSSL  310 (310)
T ss_pred             HHHHhhhcCCCCceEEEEEEEEcCCccCCCEEEEEEEeCCCEEEEEEEEecCCeEEEEEEEEEecccCCC
Confidence            9988887778888888999999999999999999999888889999888889999999999999888876

>KOG1206 consensus Peroxisomal multifunctional beta-oxidation protein and related enzymes [Lipid transport and metabolism] Back     alignment and domain information
>cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A Back     alignment and domain information
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional Back     alignment and domain information
>COG3777 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2030 MaoC Acyl dehydratase [Lipid metabolism] Back     alignment and domain information
>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes Back     alignment and domain information
>PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function Back     alignment and domain information
>cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional Back     alignment and domain information
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional Back     alignment and domain information
>cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG2030 MaoC Acyl dehydratase [Lipid metabolism] Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A Back     alignment and domain information
>PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional Back     alignment and domain information
>PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes Back     alignment and domain information
>cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>PLN02864 enoyl-CoA hydratase Back     alignment and domain information
>PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ Back     alignment and domain information
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>TIGR02286 PaaD phenylacetic acid degradation protein PaaD Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) Back     alignment and domain information
>cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>TIGR02286 PaaD phenylacetic acid degradation protein PaaD Back     alignment and domain information
>PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes [] Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>TIGR01749 fabA beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA Back     alignment and domain information
>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>PRK10800 acyl-CoA thioesterase YbgC; Provisional Back     alignment and domain information
>TIGR00369 unchar_dom_1 uncharacterized domain 1 Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated Back     alignment and domain information
>PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B Back     alignment and domain information
>COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] Back     alignment and domain information
>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases Back     alignment and domain information
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ Back     alignment and domain information
>TIGR00369 unchar_dom_1 uncharacterized domain 1 Back     alignment and domain information
>PRK10800 acyl-CoA thioesterase YbgC; Provisional Back     alignment and domain information
>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK11688 hypothetical protein; Provisional Back     alignment and domain information
>PRK11688 hypothetical protein; Provisional Back     alignment and domain information
>COG5496 Predicted thioesterase [General function prediction only] Back     alignment and domain information
>KOG1206 consensus Peroxisomal multifunctional beta-oxidation protein and related enzymes [Lipid transport and metabolism] Back     alignment and domain information
>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A Back     alignment and domain information
>COG0824 FcbC Predicted thioesterase [General function prediction only] Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>TIGR00189 tesB acyl-CoA thioesterase II Back     alignment and domain information
>PRK10254 thioesterase; Provisional Back     alignment and domain information
>cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site Back     alignment and domain information
>PLN02322 acyl-CoA thioesterase Back     alignment and domain information
>PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes [] Back     alignment and domain information
>cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site Back     alignment and domain information
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>PRK10293 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase Back     alignment and domain information
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase Back     alignment and domain information
>COG0824 FcbC Predicted thioesterase [General function prediction only] Back     alignment and domain information
>PLN02647 acyl-CoA thioesterase Back     alignment and domain information
>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>PRK10526 acyl-CoA thioesterase II; Provisional Back     alignment and domain information
>PRK10254 thioesterase; Provisional Back     alignment and domain information
>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] Back     alignment and domain information
>PLN02370 acyl-ACP thioesterase Back     alignment and domain information
>COG1607 Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>PF12119 DUF3581: Protein of unknown function (DUF3581); InterPro: IPR021974 This family consists of uncharacterised bacterial proteins Back     alignment and domain information
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family Back     alignment and domain information
>PRK10293 acyl-CoA esterase; Provisional Back     alignment and domain information
>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] Back     alignment and domain information
>PRK10694 acyl-CoA esterase; Provisional Back     alignment and domain information
>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A Back     alignment and domain information
>PLN02322 acyl-CoA thioesterase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family Back     alignment and domain information
>TIGR02447 yiiD_Cterm thioesterase domain, putative Back     alignment and domain information
>COG1607 Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] Back     alignment and domain information
>PF02551 Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IPR003703 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH) Back     alignment and domain information
>PRK10694 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated Back     alignment and domain information
>TIGR00189 tesB acyl-CoA thioesterase II Back     alignment and domain information
>PRK10526 acyl-CoA thioesterase II; Provisional Back     alignment and domain information
>cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) Back     alignment and domain information
>TIGR02447 yiiD_Cterm thioesterase domain, putative Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] Back     alignment and domain information
>TIGR01749 fabA beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA Back     alignment and domain information
>cd03444 Thioesterase_II_repeat1 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
1s9c_A298 Crystal Structure Analysis Of The 2-Enoyl-Coa Hydra 4e-55
3oml_A613 Structure Of Full-Length Peroxisomal Multifunctiona 4e-46
2cdh_S248 Architecture Of The Thermomyces Lanuginosus Fungal 2e-44
3kh8_A332 Crystal Structure Of Maoc-Like Dehydratase From Phy 4e-40
3khp_A311 Crystal Structure Of A Possible Dehydrogenase From 8e-33
1pn2_A280 Crystal Structure Analysis Of The Selenomethionine 2e-29
1pn4_A280 Crystal Structure Of 2-Enoyl-Coa Hydratase 2 Domain 3e-29
1iq6_A134 (R)-Hydratase From A. Caviae Involved In Pha Biosyn 7e-04
>pdb|1S9C|A Chain A, Crystal Structure Analysis Of The 2-Enoyl-Coa Hydratase 2 Domain Of Human Peroxisomal Multifunctional Enzyme Type 2 Length = 298 Back     alignment and structure 
Iteration: 1

 Score =  211 bits (537), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 125/306 (40%), Positives = 178/306 (58%), Gaps = 21/306 (6%)
Query: 1   MAKSSGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQ 60
           MA +SG    +   QKLP   ++ YTE +A +YALGVGA  +D  D   LK++Y   G  
Sbjct: 1   MAATSGFAGAI--GQKLPPF-SYAYTELEAIMYALGVGASIKDPKD---LKFIYE--GSS 52
Query: 61  FIQVLPTFSALFSFE-LEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACI 119
               LPTF  +   + +   G  ++PGL  +   +LHG+QY+ELYKP P +  ++ EA +
Sbjct: 53  DFSCLPTFGVIIGQKSMMGGGLAEIPGLSINFAKVLHGEQYLELYKPLPRAGKLKCEAVV 112
Query: 120 AGLHDKGKAAILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVS 179
           A + DKG   ++ ++  SY+ +  EL+C N+ + FL G+GGF          K  +  V 
Sbjct: 113 ADVLDKGSGVVIIMDVYSYSEK--ELICHNQFSLFLVGSGGFGG--------KRTSDKVK 162
Query: 180 V-VKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGF 238
           V V IP   P AV  D T  +QA +YRLSGD+NPLH DP  A  AGF +PILHGLCT GF
Sbjct: 163 VAVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGF 222
Query: 239 AVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALS 298
           + R +++     D +  K + +RF   VYPG+TL TEMW +G R+ +Q KV+E     +S
Sbjct: 223 SARRVLQQFADNDVSRFKAVKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVIS 282
Query: 299 -GFVDV 303
             +VD+
Sbjct: 283 NAYVDL 288
>pdb|3OML|A Chain A, Structure Of Full-Length Peroxisomal Multifunctional Enzyme Type 2 From Drosophila Melanogaster Length = 613 Back     alignment and structure
>pdb|2CDH|S Chain S, Architecture Of The Thermomyces Lanuginosus Fungal Fatty Acid Synthase At 5 Angstrom Resolution. Length = 248 Back     alignment and structure
>pdb|3KH8|A Chain A, Crystal Structure Of Maoc-Like Dehydratase From Phytophthora Capsici Length = 332 Back     alignment and structure
>pdb|3KHP|A Chain A, Crystal Structure Of A Possible Dehydrogenase From Mycobacterium Tuberculosis At 2.3a Resolution Length = 311 Back     alignment and structure
>pdb|1PN2|A Chain A, Crystal Structure Analysis Of The Selenomethionine Labelled 2-Enoyl-Coa Hydratase 2 Domain Of Candida Tropicalis Multifunctional Enzyme Type 2 Length = 280 Back     alignment and structure
>pdb|1PN4|A Chain A, Crystal Structure Of 2-Enoyl-Coa Hydratase 2 Domain Of Candida Tropicalis Multifunctional Enzyme Type 2 Complexed With (3r)-Hydroxydecanoyl-Coa. Length = 280 Back     alignment and structure
>pdb|1IQ6|A Chain A, (R)-Hydratase From A. Caviae Involved In Pha Biosynthesis Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 1e-115
1s9c_A298 Peroxisomal multifunctional enzyme type 2; hot-DOG 3e-85
1pn2_A280 Peroxisomal hydratase-dehydrogenase-epimerase; hot 6e-82
3khp_A311 MAOC family protein; dehydrogenase, oxidoreductase 1e-73
3kh8_A332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00 1e-70
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 1e-13
2b3n_A159 Hypothetical protein AF1124; structural genomics, 1e-13
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 7e-13
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 1e-11
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 1e-10
1q6w_A161 Monoamine oxidase regulatory protein, putative; st 2e-09
4e3e_A 352 MAOC domain protein dehydratase; structural genomi 3e-08
4e3e_A352 MAOC domain protein dehydratase; structural genomi 3e-08
4ffu_A176 Oxidase; structural genomics, protein structure in 5e-08
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 9e-08
2bi0_A 337 Hypothetical protein RV0216; conserved hypothetica 1e-07
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural prote 4e-06
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
 Score =  345 bits (887), Expect = e-115
 Identities = 102/302 (33%), Positives = 156/302 (51%), Gaps = 17/302 (5%)

Query: 14  SQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFS 73
                 +  F +  ++   YALG+GA      +A +++++Y EN   F   +PTF  L  
Sbjct: 316 GGGDAIEDAFEFNSKELITYALGIGA---SVKNAKDMRFLY-ENDADF-AAIPTFFVLPG 370

Query: 74  F----ELEPSGAIDLPGLQHDPRLLLHGQQYMELYKPFPSSASIRNEACIAGLHDKGKAA 129
                  +   +  LP  Q D   +LHG+QY+E+    P+S ++     +  + DKG  A
Sbjct: 371 LLLQMSTDKLLSKALPNSQVDFSNILHGEQYLEIVDDLPTSGTLLTNGKVFDVMDKGSGA 430

Query: 130 ILEIETKSYNAESGELLCMNRMTAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPF 189
           ++   ++S++ ESG LL  N+ T F+ GAG F     P +        V +   P  QP 
Sbjct: 431 VVVTNSESFD-ESGRLLVRNQSTTFIVGAGKFGGKKDPIAG------VVPLQPAPNRQPD 483

Query: 190 AVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICR 249
           A  +  T   QA +YRLSGD NPLH DP +A  AGF  PILHGLCT+GF+VRA++     
Sbjct: 484 ATVQYTTSEDQAALYRLSGDKNPLHIDPQMALLAGFKTPILHGLCTLGFSVRAVLAQFAD 543

Query: 250 GDPNMVKNIFSRFLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALS-GFVDVHRLAS 308
            +P + K +  RF   V PG+TL  ++W QG R+ ++  V E  +  +S  +VD+    +
Sbjct: 544 NNPALFKAVKVRFSGPVIPGQTLRVDLWKQGTRINFRTVVVETGKEVISGAYVDLKSSQA 603

Query: 309 SL 310
            L
Sbjct: 604 KL 605
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Length = 298 Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Length = 280 Back     alignment and structure
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Length = 311 Back     alignment and structure
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Length = 332 Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Length = 148 Back     alignment and structure
>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} SCOP: d.38.1.4 PDB: 2b3m_A 3k67_A Length = 159 Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Length = 134 Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Length = 2060 Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Length = 2051 Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Length = 161 Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Length = 352 Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Length = 352 Back     alignment and structure
>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Length = 176 Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Length = 154 Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Length = 337 Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Length = 151 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
3kh8_A332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00 100.0
3khp_A311 MAOC family protein; dehydrogenase, oxidoreductase 100.0
1s9c_A298 Peroxisomal multifunctional enzyme type 2; hot-DOG 100.0
1pn2_A280 Peroxisomal hydratase-dehydrogenase-epimerase; hot 100.0
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 100.0
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 100.0
4e3e_A352 MAOC domain protein dehydratase; structural genomi 100.0
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 100.0
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 100.0
2bi0_A337 Hypothetical protein RV0216; conserved hypothetica 99.97
3k67_A159 Putative dehydratase AF1124; hypothetical protein 99.91
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 99.9
2b3n_A159 Hypothetical protein AF1124; structural genomics, 99.89
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 99.89
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 99.88
4ffu_A176 Oxidase; structural genomics, protein structure in 99.87
1q6w_A161 Monoamine oxidase regulatory protein, putative; st 99.86
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural prote 99.83
4e3e_A 352 MAOC domain protein dehydratase; structural genomi 99.78
2bi0_A 337 Hypothetical protein RV0216; conserved hypothetica 99.78
4ffu_A176 Oxidase; structural genomics, protein structure in 99.68
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural prote 99.64
1q6w_A161 Monoamine oxidase regulatory protein, putative; st 99.62
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 99.61
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 99.57
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 99.53
2b3n_A159 Hypothetical protein AF1124; structural genomics, 99.5
3k67_A159 Putative dehydratase AF1124; hypothetical protein 99.34
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, bet 98.71
3khp_A311 MAOC family protein; dehydrogenase, oxidoreductase 98.7
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene re 98.61
3kh8_A332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00 98.57
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malony 98.52
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 98.48
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd 98.48
1s9c_A298 Peroxisomal multifunctional enzyme type 2; hot-DOG 98.46
3bnv_A152 CJ0977; virulence factor, hot-DOG fold, flagel unk 98.31
1pn2_A280 Peroxisomal hydratase-dehydrogenase-epimerase; hot 98.31
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 98.31
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 98.28
2cf2_C342 Fatty acid synthase, DH domain; transferase, fatty 98.27
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics 98.13
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d 98.11
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 97.92
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 97.91
2gvh_A288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 97.86
2h4u_A145 Thioesterase superfamily member 2; structural geno 97.83
3b7k_A333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 97.81
3esi_A129 Uncharacterized protein; protein from erwinia caro 97.73
4i83_A152 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; 97.7
2cwz_A141 Thioesterase family protein; structural genomics, 97.69
4gak_A250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 97.66
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 97.62
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 97.61
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 97.6
2own_A262 Putative oleoyl-[acyl-carrier protein] thioestera; 97.6
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, s 97.54
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 97.47
2pim_A141 Phenylacetic acid degradation-related protein; thi 97.46
2qwz_A159 Phenylacetic acid degradation-related protein; put 97.44
2ess_A248 Acyl-ACP thioesterase; NP_810988.1, structural gen 97.4
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 97.37
1vh5_A148 Hypothetical protein YDII; PSI, protein structure 97.35
4i82_A137 Putative uncharacterized protein; PAAI/YDII-like, 97.35
4h4g_A160 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 97.35
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 97.32
4a0z_A190 Transcription factor FAPR; lipid homeostasis; HET: 97.3
1zki_A133 Hypothetical protein PA5202; structural genomics, 97.24
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 97.23
3qoo_A138 Uncharacterized protein; structural genomics, PSI- 97.23
1vh9_A149 P15, hypothetical protein YBDB; structural genomic 97.17
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene re 97.13
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl 97.09
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malony 97.02
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 96.99
4ae7_A220 Thioesterase superfamily member 5; hydrolase, hotd 96.96
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 96.95
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 96.94
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 96.92
1o0i_A138 Hypothetical protein HI1161; structural genomics, 96.91
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 96.84
2cwz_A141 Thioesterase family protein; structural genomics, 96.76
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, bet 96.71
4ae8_A211 Thioesterase superfamily member 4; hydrolase, hotd 96.65
4i82_A137 Putative uncharacterized protein; PAAI/YDII-like, 96.63
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 96.61
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 96.56
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 96.53
3e1e_A141 Thioesterase family protein; structural genomics, 96.44
2h4u_A145 Thioesterase superfamily member 2; structural geno 96.37
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, 96.35
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, ac 96.34
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd 96.32
2q78_A153 Uncharacterized protein; structural genomics, join 96.32
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 96.3
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 96.21
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 96.14
2eis_A133 Hypothetical protein TTHB207; COA binding motif, N 96.14
3q62_A175 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 96.07
2cye_A133 TTHA1846, putative thioesterase; structural genomi 96.05
1sh8_A154 Hypothetical protein PA5026; structural genomics, 96.01
1sh8_A154 Hypothetical protein PA5026; structural genomics, 96.01
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 96.01
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 95.97
4b0b_A171 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 95.96
3bbj_A 272 Putative thioesterase II; structural genomics, joi 95.91
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 95.89
1vh9_A149 P15, hypothetical protein YBDB; structural genomic 95.88
1vh5_A148 Hypothetical protein YDII; PSI, protein structure 95.88
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 95.87
3bnv_A152 CJ0977; virulence factor, hot-DOG fold, flagel unk 95.86
2fuj_A137 Conserved hypothetical protein; structural genomic 95.86
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d 95.8
1njk_A156 Hypothetical protein YBAW; structural genomics, th 95.79
3gek_A146 Putative thioesterase YHDA; structure genomics, NE 95.79
2hlj_A157 Hypothetical protein; putative thioesterase, struc 95.75
2qwz_A159 Phenylacetic acid degradation-related protein; put 95.73
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; struct 95.71
2fuj_A137 Conserved hypothetical protein; structural genomic 95.69
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics 95.66
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 95.65
3hdu_A157 Putative thioesterase; structural genomics, joint 95.62
1tbu_A118 Peroxisomal acyl-coenzyme A thioester hydrolase 1; 95.61
1o0i_A138 Hypothetical protein HI1161; structural genomics, 95.58
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 95.58
3cjy_A 259 Putative thioesterase; YP_496845.1, structural gen 95.5
2hlj_A157 Hypothetical protein; putative thioesterase, struc 95.5
2egj_A128 Hypothetical protein AQ_1494; structural genomics; 95.49
3gek_A146 Putative thioesterase YHDA; structure genomics, NE 95.48
3r87_A135 Putative uncharacterized protein; unknown function 95.46
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 95.4
3hdu_A157 Putative thioesterase; structural genomics, joint 95.4
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 95.38
1s5u_A138 Protein YBGC; structural genomics, hypothetical pr 95.37
2egj_A128 Hypothetical protein AQ_1494; structural genomics; 95.37
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 95.3
4h4g_A160 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 95.28
3rqb_A 275 Uncharacterized protein; structural genomics, PSI- 95.27
4i83_A152 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; 95.23
3qoo_A138 Uncharacterized protein; structural genomics, PSI- 95.21
3ck1_A150 Putative thioesterase; structural genomics, joint 95.17
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1 95.04
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 95.04
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACO 95.03
2cye_A133 TTHA1846, putative thioesterase; structural genomi 95.03
1sc0_A138 Hypothetical protein HI1161; structural genomics, 94.98
1c8u_A 285 Acyl-COA thioesterase II; internal repeats, hydrol 94.97
2gf6_A135 Conserved hypothetical protein; putative thioester 94.96
3u0a_A 285 Acyl-COA thioesterase II TESB2; structural genomic 94.96
2w3x_A147 CALE7; hydrolase, hotdog fold, thioesterase, enedi 94.94
4i4j_A159 ACP-polyene thioesterase; structural genomics, PSI 94.94
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 94.93
1zki_A133 Hypothetical protein PA5202; structural genomics, 94.88
2xem_A150 DYNE7, TEBC; biosynthetic protein, polyketide bios 94.87
1z54_A132 Probable thioesterase; hypothetical protein, struc 94.85
3ck1_A150 Putative thioesterase; structural genomics, joint 94.82
4ae7_A220 Thioesterase superfamily member 5; hydrolase, hotd 94.77
3e1e_A141 Thioesterase family protein; structural genomics, 94.75
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, s 94.72
1s5u_A138 Protein YBGC; structural genomics, hypothetical pr 94.71
4b8u_A171 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 94.71
2ali_A158 Hypothetical protein PA2801; structural genomics, 94.61
1njk_A156 Hypothetical protein YBAW; structural genomics, th 94.6
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural 94.57
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bac 94.54
2pim_A141 Phenylacetic acid degradation-related protein; thi 94.49
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural 94.49
4ien_A163 Putative acyl-COA hydrolase; hot DOG fold; HET: CO 94.46
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1 94.46
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c 94.45
3rd7_A 286 Acyl-COA thioesterase; seattle structur genomics c 94.44
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; struct 94.43
2hx5_A152 Hypothetical protein; thioesterase/thiol ester deh 94.4
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, ac 94.38
2eis_A133 Hypothetical protein TTHB207; COA binding motif, N 94.38
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c 94.31
2xem_A150 DYNE7, TEBC; biosynthetic protein, polyketide bios 94.29
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACO 94.29
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural 94.26
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, 94.24
3r87_A135 Putative uncharacterized protein; unknown function 94.24
4a0z_A190 Transcription factor FAPR; lipid homeostasis; HET: 94.2
2cf2_C 342 Fatty acid synthase, DH domain; transferase, fatty 94.18
2w3x_A147 CALE7; hydrolase, hotdog fold, thioesterase, enedi 94.15
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme 94.11
1sc0_A138 Hypothetical protein HI1161; structural genomics, 94.07
4ae8_A211 Thioesterase superfamily member 4; hydrolase, hotd 94.06
1yoc_A147 Hypothetical protein PA1835; structural genomics, 94.05
2ali_A158 Hypothetical protein PA2801; structural genomics, 94.05
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bac 94.04
2hx5_A152 Hypothetical protein; thioesterase/thiol ester deh 93.98
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, 93.96
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl 93.9
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural 93.85
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; acy 93.82
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomi 93.78
2gf6_A135 Conserved hypothetical protein; putative thioester 93.72
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, 93.68
1z54_A132 Probable thioesterase; hypothetical protein, struc 93.61
4i4j_A159 ACP-polyene thioesterase; structural genomics, PSI 93.27
4b0b_A171 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 92.7
4ien_A163 Putative acyl-COA hydrolase; hot DOG fold; HET: CO 91.89
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; acy 91.88
3q62_A175 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 91.41
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACO 90.43
1yoc_A147 Hypothetical protein PA1835; structural genomics, 90.36
1c8u_A285 Acyl-COA thioesterase II; internal repeats, hydrol 90.32
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACO 89.86
3u0a_A285 Acyl-COA thioesterase II TESB2; structural genomic 89.21
2ess_A 248 Acyl-ACP thioesterase; NP_810988.1, structural gen 88.64
3rd7_A286 Acyl-COA thioesterase; seattle structur genomics c 88.55
1t82_A155 Hypothetical acetyltransferase; structural genomic 88.23
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomi 87.92
2own_A 262 Putative oleoyl-[acyl-carrier protein] thioestera; 87.88
2q78_A153 Uncharacterized protein; structural genomics, join 87.59
3b7k_A 333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 87.3
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme 87.25
3cjy_A259 Putative thioesterase; YP_496845.1, structural gen 86.59
2gvh_A288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 86.0
1t82_A155 Hypothetical acetyltransferase; structural genomic 85.13
4b8u_A171 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 85.04
4gak_A 250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 81.52
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Back     alignment and structure
Probab=100.00  E-value=2.8e-58  Score=422.95  Aligned_cols=283  Identities=36%  Similarity=0.623  Sum_probs=245.4

Q ss_pred             CcCCCChhhhcCCCCCCcceEEechhHHHHHHhhcCCCCCCCCCcccccceeeccCcCCccccceeeeccccCCCCC---
Q 021623            3 KSSGINPELLLSQKLPEQKTFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFELEPS---   79 (310)
Q Consensus         3 ~~~~~d~~~~vG~~~~~~~~~~vt~~~i~~yA~avG~~~~~Pl~~d~~~~~~~~~g~~~~~apPtf~~~l~~~~~~~---   79 (310)
                      .+|+||.++++|+++++ .+++|+++||++||++||        .+++.|+||  ||++++|||||++++.+++..+   
T Consensus        33 ~~M~id~~~~~g~~~~~-~~~~~~~~dv~lYAlavG--------~~~l~y~~E--~~~~~~a~PTF~~v~~~~~~~~~~~  101 (332)
T 3kh8_A           33 GSMSVNVDKILNSPEAT-YTATYNQRDLLMYAVGIG--------ESDLQFTYE--FDEKFSAFPLYPVCLPFKGQSQDVV  101 (332)
T ss_dssp             ----CCHHHHHHSCCEE-EEEEECHHHHHHHHHHTT--------CCCHHHHCT--TSTTCCCCTTGGGGHHHHTTCSSCC
T ss_pred             ccCCcCHHHhcCCcCCC-EEEEECHHHHHHHHhhcC--------CCCCceecc--CcCCccccceeEEEeeecccccccc
Confidence            37999999999999998 899999999999999999        257788888  5689999999999999865110   


Q ss_pred             --C-C-C--CCCCC-CCCCceeeeeeEEEEEeccC-CCCcEEEEEEEEEEEEEcCCeEEEEEEEEEEECCCCcEEEEEEE
Q 021623           80 --G-A-I--DLPGL-QHDPRLLLHGQQYMELYKPF-PSSASIRNEACIAGLHDKGKAAILEIETKSYNAESGELLCMNRM  151 (310)
Q Consensus        80 --~-~-~--~~~~~-~~~~~~~vH~~~~~~~~~Pl-~~gd~l~~~~~v~~v~~k~~G~~v~~~~~~~~~~~Ge~v~~~~~  151 (310)
                        . . +  ..+|+ +||+.++||++|+|+||+|| ++|++|+++++|.++++|++|.+++++++  .+++|++||++++
T Consensus       102 ~~~~~~~~~~~~Glp~~d~~~lVHgeq~i~~~rPl~~~g~~l~~~s~v~~v~dk~~G~lv~v~~~--~~~~Gelv~~~~s  179 (332)
T 3kh8_A          102 PFPPETISAAPDGMPSFNPAMILHGEQSVEILRPLDPSGGTLTGKTKVISFYDKGKGTLMETQTQ--FEDGNGPVAKLIS  179 (332)
T ss_dssp             CSSCHHHHCCCTTCCCCCTTSEEEEEEEEEESSCCCTTCEEEEEEEEEEEEEECSSEEEEEEEEE--EEETTEEEEEEEE
T ss_pred             chhhhhhcccccCCCCCCccceEEeccEEEEecCCCCCCCEEEEEEEEEEEEEcCCceEEEEEEE--EccCCeEEEEEEE
Confidence              0 0 1  24566 67999999999999999999 99999999999999999999998888887  3689999999999


Q ss_pred             EEEEeccCCCCCCCCCCCCCcCCCCCcccCCCCCCCCceEeeecCHHHHHHHHHHhCCCCCCCCCHHHHhhCCCCCceec
Q 021623          152 TAFLRGAGGFSNSSQPFSYSKYQTIPVSVVKIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILH  231 (310)
Q Consensus       152 t~~~rg~~~~~~~~~p~~~~~~~~~~~~~~~~p~~~p~~~~~~~~~~d~~~~~~~sgD~npiH~d~~~A~~~gf~~~i~h  231 (310)
                      ++++||.+++++++.|..         +....|++.|++.+...|..|+.+||++|||+||||+|+++|+..||+++|+|
T Consensus       180 t~~~Rg~~g~g~~~~p~~---------~~~~~P~~~pd~~~~~~t~~d~~~fa~lsGD~nPiH~D~~~A~~~gf~~~IaH  250 (332)
T 3kh8_A          180 GSFIRGLTGYEGKGRKLP---------ARVQIPKRQPDFNDEFKTSPHQAQVYRLSGDYNSLHIDPEIAKSVGFKQPILH  250 (332)
T ss_dssp             EEEEESCCSSCCEESCCC---------CCCCCCSSCCSEEEEEECCTTHHHHHGGGSCCCGGGTCHHHHHHTTCSSCCCC
T ss_pred             EEEEEcCCCCCCCCCCCC---------CCCCCCCCCCCeEEecCcHHHHHHHHHHhCCCCCCccCHHHHHhcCCCCceEC
Confidence            999999987765433321         12245666789999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHHhhcCCCceEEEEEEEECcCCCCCCEEEEEEEEEC-cEEEEEEEEecCCcEEEE-EEEEEEecc
Q 021623          232 GLCTMGFAVRAIIKFICRGDPNMVKNIFSRFLLHVYPGETLVTEMWLQG-LRVIYQVKVKERNRSALS-GFVDVHRLA  307 (310)
Q Consensus       232 G~~~~~~~~~~~~~~~~~g~~~~~~~~~~rf~~Pv~~gd~l~~~~~~~~-~~v~~~~~~~~~g~~vl~-g~a~v~~p~  307 (310)
                      |||+++++.+++.++++++++..+.++++||.+||++||+|++++|+.+ +.+.|++++||+|++|++ |++++.+|.
T Consensus       251 G~~t~al~~~~~~~~~~~~~~~~~~~~~~rF~~PV~~Gdtl~~~~~~~~~g~v~~~~~~~q~g~~Vl~~g~a~~~~p~  328 (332)
T 3kh8_A          251 GLCSMGVASRALFKQFCGGDVARFKSIRVRFSSPCFPGETIQTRMWQEGSGKVLFQAVVKERGAVIVDGGEFVYTQDA  328 (332)
T ss_dssp             HHHHHHHHHHHHHHHHSTTCGGGEEEEEEEECSCCCTTCEEEEEEEECSTTEEEEEEEETTTTEEEEEEEEEEECCGG
T ss_pred             HHHHHHHHHHHHHHhhcCCCcceEEEEEEEEecccCCCCEEEEEEEEECCCEEEEEEEEccCCcEEEeCeEEEEecCC
Confidence            9999999999888887777888999999999999999999999999976 478999888999999999 999999997
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A Back     alignment and structure
>3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A Back     alignment and structure
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Back     alignment and structure
>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Back     alignment and structure
>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} Back     alignment and structure
>4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 Back     alignment and structure
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Back     alignment and structure
>4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Back     alignment and structure
>3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A Back     alignment and structure
>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* Back     alignment and structure
>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Back     alignment and structure
>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Back     alignment and structure
>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Back     alignment and structure
>2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Back     alignment and structure
>3q62_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; structural genomics, center for structural genomics of infec diseases, csgid; HET: MES; 1.40A {Yersinia pseudotuberculosis} SCOP: d.38.1.2 PDB: 1mka_A* 1mkb_A Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Back     alignment and structure
>4b0b_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, bacterial virulence, drug DI; HET: 54F; 1.90A {Pseudomonas aeruginosa} PDB: 4b0c_A* 4b0j_A* 4b8u_A* 4b0i_A* Back     alignment and structure
>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Back     alignment and structure
>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 Back     alignment and structure
>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 Back     alignment and structure
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} Back     alignment and structure
>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 Back     alignment and structure
>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A Back     alignment and structure
>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} Back     alignment and structure
>3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A Back     alignment and structure
>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Back     alignment and structure
>3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} Back     alignment and structure
>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} Back     alignment and structure
>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A Back     alignment and structure
>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Back     alignment and structure
>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} Back     alignment and structure
>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>4b8u_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, inhibitor, bacterial virulen discovery; HET: IBK; 2.76A {Pseudomonas aeruginosa} Back     alignment and structure
>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Back     alignment and structure
>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Back     alignment and structure
>3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 Back     alignment and structure
>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Back     alignment and structure
>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Back     alignment and structure
>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} Back     alignment and structure
>4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Back     alignment and structure
>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A Back     alignment and structure
>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} Back     alignment and structure
>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 Back     alignment and structure
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Back     alignment and structure
>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} Back     alignment and structure
>4b0b_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, bacterial virulence, drug DI; HET: 54F; 1.90A {Pseudomonas aeruginosa} PDB: 4b0c_A* 4b0j_A* 4b8u_A* 4b0i_A* Back     alignment and structure
>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Back     alignment and structure
>3q62_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; structural genomics, center for structural genomics of infec diseases, csgid; HET: MES; 1.40A {Yersinia pseudotuberculosis} SCOP: d.38.1.2 PDB: 1mka_A* 1mkb_A Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Back     alignment and structure
>3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} Back     alignment and structure
>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 Back     alignment and structure
>4b8u_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, inhibitor, bacterial virulen discovery; HET: IBK; 2.76A {Pseudomonas aeruginosa} Back     alignment and structure
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 310
d1pn2a1148 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of 5e-43
d1s9ca1126 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain 2e-34
d1s9ca2154 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain o 1e-29
d1pn2a2124 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain 2e-26
d2b3na1154 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Ar 2e-15
d1iq6a_132 d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Ae 2e-13
d1q6wa_151 d.38.1.4 (A:) Monoamine oxidase regulatory protein 3e-08
d2bi0a1178 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0 3e-06
d2c2ia1149 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {My 5e-06
d2bi0a2152 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/M 3e-04
>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 148 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: MaoC-like
domain: 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase
species: Yeast (Candida tropicalis) [TaxId: 5482]

 Score =  143 bits (361), Expect = 5e-43
 Identities = 42/148 (28%), Positives = 69/148 (46%), Gaps = 10/148 (6%)

Query: 22  TFTYTERDAAIYALGVGACGRDAVDADELKYVYHENGQQFIQVLPTFSALFSFE-LEPSG 80
            + + +RD  +Y + +GA         +LKYVY EN   F QV+PTF  L +F   +   
Sbjct: 3   VWRFDDRDVILYNIALGAT------TKQLKYVY-ENDSDF-QVIPTFGHLITFNSGKSQN 54

Query: 81  AIDLPGLQHDPRLLLHGQQYMELYK-PFPSSASIRNEACIAGLHDKGKAAILEIETKSYN 139
           +        +P LLLHG+ Y++++  P P+   I+          KG   ++   +KS +
Sbjct: 55  SFAKLLRNFNPMLLLHGEHYLKVHSWPPPTEGEIKTTFEPIATTPKGTNVVIVHGSKSVD 114

Query: 140 AESGELLCMNRMTAFLRGAGGFSNSSQP 167
            +SGEL+  N  T F+R     +     
Sbjct: 115 NKSGELIYSNEATYFIRNCQADNKVYAD 142
>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 124 Back     information, alignment and structure
>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 154 Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Length = 132 Back     information, alignment and structure
>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 151 Back     information, alignment and structure
>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 178 Back     information, alignment and structure
>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 149 Back     information, alignment and structure
>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 152 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
d1s9ca1126 2-enoyl-coa hydratase domain of multifunctional pe 99.97
d1pn2a1148 2-enoyl-coa hydratase domain of multifunctional pe 99.96
d1s9ca2154 2-enoyl-coa hydratase domain of multifunctional pe 99.96
d1pn2a2124 2-enoyl-coa hydratase domain of multifunctional pe 99.95
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae 99.92
d2b3na1154 Hypothetical protein AF1124 {Archaeon Archaeoglobu 99.87
d1q6wa_151 Monoamine oxidase regulatory protein {Archaeon Arc 99.83
d2c2ia1149 Hypothetical protein Rv0130 {Mycobacterium tubercu 99.8
d2bi0a1178 Hypothetical protein Rv0216/MT0226 {Mycobacterium 99.8
d1q6wa_151 Monoamine oxidase regulatory protein {Archaeon Arc 99.71
d2bi0a2152 Hypothetical protein Rv0216/MT0226 {Mycobacterium 99.64
d2c2ia1149 Hypothetical protein Rv0130 {Mycobacterium tubercu 99.62
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae 99.61
d2bi0a1178 Hypothetical protein Rv0216/MT0226 {Mycobacterium 99.47
d2b3na1154 Hypothetical protein AF1124 {Archaeon Archaeoglobu 99.25
d2bi0a2152 Hypothetical protein Rv0216/MT0226 {Mycobacterium 98.69
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilu 98.6
d1s9ca1126 2-enoyl-coa hydratase domain of multifunctional pe 98.44
d1s9ca2154 2-enoyl-coa hydratase domain of multifunctional pe 98.36
d1pn2a2124 2-enoyl-coa hydratase domain of multifunctional pe 98.27
d2f41a1111 Transcription factor FapR, C-terminal domain {Baci 98.06
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilu 97.92
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus h 97.66
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermu 97.36
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentu 97.21
d1u1za_145 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo 97.16
d1z6ba1146 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria 97.14
d2ov9a1203 Hypothetical protein RHA1_ro05818 {Rhodococcus sp. 97.01
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escher 96.88
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [ 96.81
d1s5ua_129 Hypothetical protein YbgC {Escherichia coli [TaxId 96.18
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escher 96.05
d1njka_133 Hypothetical protein YbaW {Escherichia coli [TaxId 96.04
d2essa1149 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 95.82
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginos 95.8
d2f41a1111 Transcription factor FapR, C-terminal domain {Baci 95.63
d1tbua1104 Peroxisomal long-chain acyl-CoA thioesterase 1, TE 95.6
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [ 95.57
d1s5ua_129 Hypothetical protein YbgC {Escherichia coli [TaxId 95.57
d1z6ba1146 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria 95.52
d2oafa1143 Hypothetical protein Jann0674 {Jannaschia sp. ccs1 95.5
d2owna1147 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 95.48
d2cyea1132 Probable thioesterase TTHA1846 {Thermus thermophil 95.4
d1u1za_145 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo 95.38
d2owna2109 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 95.34
d2q78a1130 Uncharacterized protein TM0581 {Thermotoga maritim 95.33
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenza 95.25
d2oiwa1131 GK1870 orthologue {Bacillus stearothermophilus [Ta 95.11
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus h 95.08
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId 95.06
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId 94.98
d1c8ua1114 Thioesterase II (TesB) {Escherichia coli [TaxId: 5 94.97
d2hx5a1144 Hypothetical protein PMT2055 {Prochlorococcus mari 94.96
d1z54a1132 Probable thioesterase TTHA0908 {Thermus thermophil 94.95
d1lo7a_140 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. 94.93
d2o5ua1139 Hypothetical thioesterase PA5185 {Pseudomonas aeru 94.87
d2hlja1156 Hypothetical protein PP0301 {Pseudomonas putida [T 94.87
d1njka_133 Hypothetical protein YbaW {Escherichia coli [TaxId 94.77
d2nuja1159 Hypothetical protein Jann_1972 {Jannaschia sp. CCS 94.73
d2oafa1143 Hypothetical protein Jann0674 {Jannaschia sp. ccs1 94.5
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermu 94.49
d2ov9a1203 Hypothetical protein RHA1_ro05818 {Rhodococcus sp. 94.41
d1z54a1132 Probable thioesterase TTHA0908 {Thermus thermophil 94.34
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId 94.28
d1c8ua2171 Thioesterase II (TesB) {Escherichia coli [TaxId: 5 94.27
d2essa298 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 94.26
d2essa1149 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 94.24
d2fuja1118 Hypothetical protein XCC1147 {Xanthomonas campestr 94.17
d2o5ua1139 Hypothetical thioesterase PA5185 {Pseudomonas aeru 94.04
d2hx5a1144 Hypothetical protein PMT2055 {Prochlorococcus mari 94.01
d2oiwa1131 GK1870 orthologue {Bacillus stearothermophilus [Ta 93.95
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenza 93.94
d2fuja1118 Hypothetical protein XCC1147 {Xanthomonas campestr 93.92
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId 93.9
d1q4ua_140 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp 93.79
d2owna1147 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 93.78
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentu 93.76
d2cyea1132 Probable thioesterase TTHA1846 {Thermus thermophil 93.65
d2gvha2116 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 93.19
d2nuja1159 Hypothetical protein Jann_1972 {Jannaschia sp. CCS 93.06
d2gvha1135 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 92.9
d2gvha2116 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 92.84
d1lo7a_140 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. 92.8
d1q4ua_140 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp 92.8
d1mkaa_171 beta-Hydroxydecanol thiol ester dehydrase {Escheri 92.01
d2gvha1135 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 91.63
d1ylia1142 Putative acyl-coa thioester hydrolase HI0827 {Haem 91.46
d2gf6a1134 Hypothetical protein SSO2295 {Archaeon Sulfolobus 91.43
d2hlja1156 Hypothetical protein PP0301 {Pseudomonas putida [T 91.36
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginos 91.24
d2gf6a1134 Hypothetical protein SSO2295 {Archaeon Sulfolobus 91.13
d2alia1130 Hypothetical protein PA2801 {Pseudomonas aeruginos 90.89
d1y7ua1164 Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 89.26
d2alia1130 Hypothetical protein PA2801 {Pseudomonas aeruginos 89.12
d1pn2a1148 2-enoyl-coa hydratase domain of multifunctional pe 88.39
d1vpma_155 Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta 87.95
d1vpma_155 Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta 87.82
d2owna2109 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 87.49
d1y7ua1164 Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 87.44
d1mkaa_171 beta-Hydroxydecanol thiol ester dehydrase {Escheri 86.72
d1t82a_143 Putative thioesterase SO4397 {Shewanella oneidensi 86.37
d1sh8a_153 Hypothetical protein PA5026 {Pseudomonas aeruginos 85.84
d1ylia1142 Putative acyl-coa thioester hydrolase HI0827 {Haem 83.72
d1yoca1145 Hypothetical protein PA1835 {Pseudomonas aeruginos 82.62
d2q78a1130 Uncharacterized protein TM0581 {Thermotoga maritim 80.99
d1sh8a_153 Hypothetical protein PA5026 {Pseudomonas aeruginos 80.68
>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: MaoC-like
domain: 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=8.7e-30  Score=200.86  Aligned_cols=122  Identities=48%  Similarity=0.838  Sum_probs=112.6

Q ss_pred             CCCCCCCceEeeecCHHHHHHHHHHhCCCCCCCCCHHHHhhCCCCCceechHHHHHHHHHHHHHHhhcCCCceEEEEEEE
Q 021623          182 KIPKSQPFAVFEDYTQPSQALVYRLSGDYNPLHSDPMVAKAAGFSRPILHGLCTMGFAVRAIIKFICRGDPNMVKNIFSR  261 (310)
Q Consensus       182 ~~p~~~p~~~~~~~~~~d~~~~~~~sgD~npiH~d~~~A~~~gf~~~i~hG~~~~~~~~~~~~~~~~~g~~~~~~~~~~r  261 (310)
                      .+|++.||++....++.|+.+||++|||+||||+|+++|+..||+++|+|||++++++.+++.+++.++.+..+.++++|
T Consensus         3 ~~p~~~pd~~~~~~~~~~~~~~~~lSGD~NPIH~D~~~Ak~~g~~~~IahG~l~~a~~~~~~~~~~~~~~~~~~~~~~~r   82 (126)
T d1s9ca1           3 AIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAVKAR   82 (126)
T ss_dssp             CCCSSCCSEEEEEECCTTHHHHHGGGSCCCGGGTCHHHHHTTTCSSCCCCHHHHHHHHHHHHHHHHSTTCGGGEEEEEEE
T ss_pred             CCCCCCCCeEEeeecChhHHHHHHHHCCCceeEeCHHHHhhcCCCCccchHHHHHHHHHHHHHHHhcccCceeEEEEEeE
Confidence            57788899999999999999999999999999999999999999999999999999999999888766777889999999


Q ss_pred             ECcCCCCCCEEEEEEEEECcEEEEEEEEecCCcEEEE-EEEEE
Q 021623          262 FLLHVYPGETLVTEMWLQGLRVIYQVKVKERNRSALS-GFVDV  303 (310)
Q Consensus       262 f~~Pv~~gd~l~~~~~~~~~~v~~~~~~~~~g~~vl~-g~a~v  303 (310)
                      |.+||++||+|+++.++.++.+.+++++|++|++|++ |.++|
T Consensus        83 F~~Pv~~gdtl~v~~~~~~~~v~~~~~~~~~g~~Vl~ga~~~l  125 (126)
T d1s9ca1          83 FAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDL  125 (126)
T ss_dssp             ECSCCCTTCEEEEEEEEETTEEEEEEEETTTTEEEEEEEEEEE
T ss_pred             ECCCCCCCCEEEEEEEEcCCEEEEEEEEecCCeEEEeCeEEEe
Confidence            9999999999999999999999999988999999998 45554
>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Back     information, alignment and structure
>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Back     information, alignment and structure
>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Back     information, alignment and structure
>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Back     information, alignment and structure
>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Back     information, alignment and structure
>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c8ua2 d.38.1.3 (A:116-286) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Back     information, alignment and structure
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Back     information, alignment and structure
>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Back     information, alignment and structure
>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Back     information, alignment and structure
>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure