Citrus Sinensis ID: 021636

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MEIPIPVIDFNELEGENRKKTMALLHQACEKWGFFQVDNHGIDKKLMEKVKQLVNSHYEEYLKGGFYDSELVKSLEKENKNNIRDVDWESTFFIWHRPSSNINEIRNLSEDFRNTMEDYIAQLIKLAEKLSELMCENLGLEKSYIKNAFSGEKGPSVGTKVAKYPQCPYPELVRGLREHTDAGGIILLLQDDQVPGLEFFKDGEWVKIPPSRNNTIFVNTGDQVEVLSNGRYQSALHRVMPEKNGSRLSIATFYNPANDAIISPAIKLLYPSYYSFQDYLKLYGTTKFSDKVPRLESMKEIANGHQILLS
ccccccEEEccccccccHHHHHHHHHHHHHHccCEEEEcccccHHHHHHHHHHHHHHHHcHHHcccccccccccEEEEcccccccccccCEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccEEEEccccccccccccccccccccccccEEEEECccccccEEEEEccCEEEccccccccEEEEcccEEEEEEccccccccccccccccccEEEEEEEEccccccEECccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHcccccccc
*EIPIPVIDFNELEGENRKKTMALLHQACEKWGFFQVDNHGIDKKLMEKVKQLVNSHYEEYLKGGFYDSELVKSLEKENKNNIRDVDWESTFFIWHRPSSNINEIRNLSEDFRNTMEDYIAQLIKLAEKLSELMCENLGLEKSYIKNAFSGEKGPSVGTKVAKYPQCPYPELVRGLREHTDAGGIILLLQDDQVPGLEFFKDGEWVKIPPSRNNTIFVNTGDQVEVLSNGRYQSALHRVMPEKNGSRLSIATFYNPANDAIISPAIKLLYPSYYSFQDYLKLYGTTKFSDKVPRLESMKEIA********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIPIPVIDFNELEGENRKKTMALLHQACEKWGFFQVDNHGIDKKLMEKVKQLVNSHYEEYLKGGFYDSELVKSLEKENKNNIRDVDWESTFFIWHRPSSNINEIRNLSEDFRNTxxxxxxxxxxxxxxxxxxxxxNLGLEKSYIKNAFSGEKGPSVGTKVAKYPQCPYPELVRGLREHTDAGGIILLLQDDQVPGLEFFKDGEWVKIPPSRNNTIFVNTGDQVEVLSNGRYQSALHRVMPEKNGSRLSIATFYNPANDAIISPAIKLLYPSYYSFQDYLKLYGTTKFSDKVPRLESMKEIANGHQILLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
1-aminocyclopropane-1-carboxylate oxidase 1 Enzyme involved in the ethylene biosynthesis. May promote stem elongation by maximizing the extensibility cells, possibly by activating ethylene biosynthesis, in response to very-long-chain fatty acids (VLCFAs C20:0 to C30:0).confidentQ9ZUN4
1-aminocyclopropane-1-carboxylate oxidase probableP31239
1-aminocyclopropane-1-carboxylate oxidase probableQ09052

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.17.-With reduced ascorbate as one donor, and incorporation of one atom of oxygen.probable
1.14.17.4Aminocyclopropanecarboxylate oxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W9Y, chain A
Confidence level:very confident
Coverage over the Query: 3-297
View the alignment between query and template
View the model in PyMOL