Citrus Sinensis ID: 021643


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MFGVTLLLVVTVLAVNLSYGLECCNLSSFNVHIRFSLAAMVNLTESMCWKAVARSVDSNRIGFVIYQKPVSYSCYKNREENTPPLCDGKNNLNSSWHVPLSNCISRLPTDSKGNLHSWPAPWPQRLSSKPPSLPPDSEEAFNKDTTHWYALVSDVYVGGLAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRGLIGMYHDWCESFNTYPRTYDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTLEMINKLKPVLHSLQWSTNIYHDQFLVGKKGFWRPTGGET
ccccEEEEEccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHEEEccccccccccEEEEEcccccccEEEEcccccEEEEEEccccccccccHHHcccccccccccccccccccccHHHHHHccccccccccccHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHcccEEEEEEcEEEEEEEcccccccccc
ccccEEEEHHHEcccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHEEEccccccEEEEEEEcccccHHHHHcccccccccccccccccccEcccHHcccccccccccccccccccccHHccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEHEEcHcccHHHHHHHccccEEEEEEEcccccccccEEEcccEEEEEcccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHcccEEEEEccEEEEEEEEEEccccccc
MFGVTLLLVVTVLAVNLSYgleccnlssfnVHIRFSLAAMVNLTESMCWKAVARSvdsnrigfviyqkpvsyscyknreentpplcdgknnlnsswhvplsncisrlptdskgnlhswpapwpqrlsskppslppdseeafnkdttHWYALVSDVYVGGLAINWSSVRNVMDMNASYGGFAaalidqplwvmnvvpidapdtlsiiFDRGLIGMYHDWcesfntyprtydLLHSSfllsdvtqrcdIADVAVEMDrilrpggyvLVQDTLEMINKLKPVLHSLQWStniyhdqflvgkkgfwrptgget
MFGVTLLLVVTVLAVNLSYGLECCNLSSFNVHIRFSLAAMVNLTESMCWKAVARSVDSNRIGFVIYQKPVSYSCYKNREENTPPLCDGKNNLNSSWHVPLSNCISRLPTDSKGNLHSWPAPWPQRLSSKPPSLPPDSEEAFNKDTTHWYALVSDVYVGGLAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRGLIGMYHDWCESFNTYPRTYDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTLEMINKLKPVLHSLQWSTNIYHDQFLVGKKgfwrptgget
MFGvtlllvvtvlavnlSYGLECCNLSSFNVHIRFSLAAMVNLTESMCWKAVARSVDSNRIGFVIYQKPVSYSCYKNREENTPPLCDGKNNLNSSWHVPLSNCISRLPTDSKGNLHSWPAPWPQRlsskppslppdsEEAFNKDTTHWYALVSDVYVGGLAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRGLIGMYHDWCESFNTYPRTYDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTLEMINKLKPVLHSLQWSTNIYHDQFLVGKKGFWRPTGGET
*FGVTLLLVVTVLAVNLSYGLECCNLSSFNVHIRFSLAAMVNLTESMCWKA*********IGFVIYQKPVSYSCYKN********C****NLNSSWHVPLSNCISR*************************************DTTHWYALVSDVYVGGLAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRGLIGMYHDWCESFNTYPRTYDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTLEMINKLKPVLHSLQWSTNIYHDQFLVGKKGFWR******
MFGVTLLLVVTVLAVNLSYGLECCNLSSF**H****LAAMVNLTESMCWKAVARSVDSNRIGFVIYQKPVSY*****************NNLNSSWHVPLSNCIS***************************LPPDSEEAFNKDTTHWYALVSDVYVGGLAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRGLIGMYHDWCESFNTYPRTYDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTLEMINKLKPVLHSLQWSTNIYHDQFLVGKKG**RP*****
MFGVTLLLVVTVLAVNLSYGLECCNLSSFNVHIRFSLAAMVNLTESMCWKAVARSVDSNRIGFVIYQKPVSYSCYKNREENTPPLCDGKNNLNSSWHVPLSNCISRLPTDSKGNLHSWPAPWP****************AFNKDTTHWYALVSDVYVGGLAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRGLIGMYHDWCESFNTYPRTYDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTLEMINKLKPVLHSLQWSTNIYHDQFLVGKKGFWRPTGGET
*FGVTLLLVVTVLAVNLSYGLECCNLSSFNVHIRFSLAAMVNLTESMCWKAVARSVDSNRIGFVIYQKPVSYSCYKNREENTPPLCDGKNNLNSSWHVPLSNCISRLPTDSKGNLHSWPAPWPQRLSSKPPSLPPDSEEAFNKDTTHWYALVSDVYVGGLAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRGLIGMYHDWCESFNTYPRTYDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTLEMINKLKPVLHSLQWSTNIYHDQFLVGKKGFWRP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFGVTLLLVVTVLAVNLSYGLECCNLSSFNVHIRFSLAAMVNLTESMCWKAVARSVDSNRIGFVIYQKPVSYSCYKNREENTPPLCDGKNNLNSSWHVPLSNCISRLPTDSKGNLHSWPAPWPQRLSSKPPSLPPDSEEAFNKDTTHWYALVSDVYVGGLAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRGLIGMYHDWCESFNTYPRTYDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTLEMINKLKPVLHSLQWSTNIYHDQFLVGKKGFWRPTGGET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query309 2.2.26 [Sep-21-2011]
Q9SIZ3589 Probable methyltransferas yes no 0.857 0.449 0.639 1e-100
Q9LYN3610 Probable methyltransferas no no 0.851 0.431 0.588 2e-91
Q6NPR7770 Probable methyltransferas no no 0.877 0.351 0.473 1e-76
Q0WT31770 Probable methyltransferas no no 0.870 0.349 0.466 1e-74
Q8L7V3829 Probable methyltransferas no no 0.877 0.326 0.461 5e-73
Q9SD39895 Probable methyltransferas no no 0.844 0.291 0.460 4e-72
Q9LN50724 Probable methyltransferas no no 0.893 0.381 0.452 3e-70
O22285694 Probable methyltransferas no no 0.786 0.350 0.418 1e-53
Q93YV7608 Probable methyltransferas no no 0.779 0.396 0.450 2e-53
Q9FG39682 Probable methyltransferas no no 0.773 0.350 0.416 3e-53
>sp|Q9SIZ3|PMTN_ARATH Probable methyltransferase PMT23 OS=Arabidopsis thaliana GN=At2g40280 PE=1 SV=2 Back     alignment and function desciption
 Score =  366 bits (940), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/269 (63%), Positives = 206/269 (76%), Gaps = 4/269 (1%)

Query: 40  MVNLTESMCWKAVARSVDSNRIGFVIYQKPVSYSCYKNREENTPPLCDGKNNLNSSWHVP 99
           MV+LT+S+CWK V ++VDS+ IG VIYQKP S SCY  R    PPLCD K   N SW+VP
Sbjct: 323 MVSLTKSICWKVVTKTVDSSGIGLVIYQKPTSESCYNKRSTQDPPLCD-KKEANGSWYVP 381

Query: 100 LSNCISRLPTDSKGNLHSWPAPWPQRLSSKPPSLPPDSEEAFNKDTTHWYALVSDVYVGG 159
           L+ C+S+LP+   GN+ SWP  WP+RL S  P       E   KDT  W A VSDVY+  
Sbjct: 382 LAKCLSKLPS---GNVQSWPELWPKRLVSVKPQSISVKAETLKKDTEKWSASVSDVYLKH 438

Query: 160 LAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRGLIGMYHDWC 219
           LA+NWS+VRNVMDMNA +GGFAAALI+ PLWVMNVVP+D PDTLS+++DRGLIG+YHDWC
Sbjct: 439 LAVNWSTVRNVMDMNAGFGGFAAALINLPLWVMNVVPVDKPDTLSVVYDRGLIGVYHDWC 498

Query: 220 ESFNTYPRTYDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTLEMINKLKPV 279
           ES NTYPRTYDLLHSSFLL D+TQRC+I  V  E+DRI+RPGGY++VQD +E I KL+ +
Sbjct: 499 ESVNTYPRTYDLLHSSFLLGDLTQRCEIVQVVAEIDRIVRPGGYLVVQDNMETIMKLESI 558

Query: 280 LHSLQWSTNIYHDQFLVGKKGFWRPTGGE 308
           L SL WST IY D+FLVG+KGFWRP   E
Sbjct: 559 LGSLHWSTKIYEDRFLVGRKGFWRPAKPE 587





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9LYN3|PMTM_ARATH Probable methyltransferase PMT22 OS=Arabidopsis thaliana GN=At3g56080 PE=3 SV=1 Back     alignment and function description
>sp|Q6NPR7|PMTO_ARATH Probable methyltransferase PMT24 OS=Arabidopsis thaliana GN=At1g29470 PE=1 SV=1 Back     alignment and function description
>sp|Q0WT31|PMTP_ARATH Probable methyltransferase PMT25 OS=Arabidopsis thaliana GN=At2g34300 PE=1 SV=2 Back     alignment and function description
>sp|Q8L7V3|PMTQ_ARATH Probable methyltransferase PMT26 OS=Arabidopsis thaliana GN=At5g64030 PE=1 SV=1 Back     alignment and function description
>sp|Q9SD39|PMTR_ARATH Probable methyltransferase PMT27 OS=Arabidopsis thaliana GN=At3g51070 PE=3 SV=1 Back     alignment and function description
>sp|Q9LN50|PMTS_ARATH Probable methyltransferase PMT28 OS=Arabidopsis thaliana GN=At1g19430 PE=1 SV=1 Back     alignment and function description
>sp|O22285|PMTB_ARATH Probable methyltransferase PMT11 OS=Arabidopsis thaliana GN=At2g39750 PE=2 SV=1 Back     alignment and function description
>sp|Q93YV7|PMT3_ARATH Probable methyltransferase PMT3 OS=Arabidopsis thaliana GN=At4g14360 PE=1 SV=1 Back     alignment and function description
>sp|Q9FG39|PMTC_ARATH Probable methyltransferase PMT12 OS=Arabidopsis thaliana GN=At5g06050 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query309
225448534 606 PREDICTED: probable methyltransferase PM 0.864 0.440 0.743 1e-116
356501216 595 PREDICTED: probable methyltransferase PM 0.864 0.448 0.691 1e-110
224109268 514 predicted protein [Populus trichocarpa] 0.860 0.517 0.705 1e-109
449460888 590 PREDICTED: probable methyltransferase PM 0.860 0.450 0.671 1e-108
356553765 595 PREDICTED: probable methyltransferase PM 0.867 0.450 0.670 1e-106
357492789 617 hypothetical protein MTR_5g083150 [Medic 0.864 0.432 0.661 1e-105
255559511 603 ATP binding protein, putative [Ricinus c 0.864 0.442 0.665 1e-105
356538003 594 PREDICTED: probable methyltransferase PM 0.860 0.447 0.657 1e-103
297827657 593 dehydration-responsive family protein [A 0.860 0.448 0.636 2e-99
18405331 589 putative methyltransferase PMT23 [Arabid 0.857 0.449 0.639 7e-99
>gi|225448534|ref|XP_002273466.1| PREDICTED: probable methyltransferase PMT23 [Vitis vinifera] gi|297736564|emb|CBI25435.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 200/269 (74%), Positives = 228/269 (84%), Gaps = 2/269 (0%)

Query: 39  AMVNLTESMCWKAVARSVDSNRIGFVIYQKPVSYSCYKNREENTPPLCDGKNNLNSSWHV 98
           AMVN+T+S+CWK VA++VD N IG VIYQKPVS SCY+ R+EN PP+CD K+  N SW+V
Sbjct: 338 AMVNVTKSICWKVVAKTVDLNGIGLVIYQKPVSSSCYEKRKENNPPMCDIKDKKNISWYV 397

Query: 99  PLSNCISRLPTDSKGNLHSWPAPWPQRLSSKPPSLP--PDSEEAFNKDTTHWYALVSDVY 156
           PL  CI +LP DS GN  +WP  WPQRLSSKP SLP  PD+E+ F +DT HW ALVSDVY
Sbjct: 398 PLDGCIPQLPADSMGNSQNWPVSWPQRLSSKPLSLPTEPDAEQMFYEDTKHWSALVSDVY 457

Query: 157 VGGLAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRGLIGMYH 216
           + GLA+NWSS+RNVMDMNA YGGFAAALIDQP+WVMNVVPI  PDTLS+IFDRGLIG YH
Sbjct: 458 LEGLAVNWSSIRNVMDMNAGYGGFAAALIDQPVWVMNVVPIHVPDTLSVIFDRGLIGTYH 517

Query: 217 DWCESFNTYPRTYDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTLEMINKL 276
           DWCES NTYPRTYDLLHSSFLL ++TQRCDI DVAVEMDRILRPGG++LVQDT+E+I+KL
Sbjct: 518 DWCESSNTYPRTYDLLHSSFLLGNLTQRCDIIDVAVEMDRILRPGGWLLVQDTIEIIDKL 577

Query: 277 KPVLHSLQWSTNIYHDQFLVGKKGFWRPT 305
            PVLHSL WST +Y  QFLVGKK FWRPT
Sbjct: 578 SPVLHSLHWSTTLYQGQFLVGKKDFWRPT 606




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356501216|ref|XP_003519422.1| PREDICTED: probable methyltransferase PMT23-like [Glycine max] Back     alignment and taxonomy information
>gi|224109268|ref|XP_002315142.1| predicted protein [Populus trichocarpa] gi|222864182|gb|EEF01313.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449460888|ref|XP_004148176.1| PREDICTED: probable methyltransferase PMT23-like [Cucumis sativus] gi|449507782|ref|XP_004163128.1| PREDICTED: probable methyltransferase PMT23-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356553765|ref|XP_003545223.1| PREDICTED: probable methyltransferase PMT23-like [Glycine max] Back     alignment and taxonomy information
>gi|357492789|ref|XP_003616683.1| hypothetical protein MTR_5g083150 [Medicago truncatula] gi|355518018|gb|AES99641.1| hypothetical protein MTR_5g083150 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255559511|ref|XP_002520775.1| ATP binding protein, putative [Ricinus communis] gi|223539906|gb|EEF41484.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356538003|ref|XP_003537495.1| PREDICTED: probable methyltransferase PMT23-like [Glycine max] Back     alignment and taxonomy information
>gi|297827657|ref|XP_002881711.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. lyrata] gi|297327550|gb|EFH57970.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18405331|ref|NP_565926.1| putative methyltransferase PMT23 [Arabidopsis thaliana] gi|75265917|sp|Q9SIZ3.2|PMTN_ARATH RecName: Full=Probable methyltransferase PMT23 gi|4588002|gb|AAD25943.1|AF085279_16 hypothetical ankyrin-like protein [Arabidopsis thaliana] gi|16649003|gb|AAL24353.1| Unknown protein [Arabidopsis thaliana] gi|20198017|gb|AAD25663.2| expressed protein [Arabidopsis thaliana] gi|20259948|gb|AAM13321.1| unknown protein [Arabidopsis thaliana] gi|330254712|gb|AEC09806.1| putative methyltransferase PMT23 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query309
TAIR|locus:2063078589 AT2G40280 [Arabidopsis thalian 0.857 0.449 0.628 3e-94
TAIR|locus:2013628770 AT1G29470 [Arabidopsis thalian 0.877 0.351 0.466 3e-69
TAIR|locus:2040864770 AT2G34300 [Arabidopsis thalian 0.877 0.351 0.455 3.1e-67
TAIR|locus:2160806829 AT5G64030 [Arabidopsis thalian 0.877 0.326 0.450 1.1e-66
TAIR|locus:2080823895 AT3G51070 [Arabidopsis thalian 0.857 0.296 0.456 5.8e-66
TAIR|locus:2016392724 AT1G19430 [Arabidopsis thalian 0.893 0.381 0.442 1.1e-64
TAIR|locus:2063947694 AT2G39750 [Arabidopsis thalian 0.786 0.350 0.414 3.8e-53
TAIR|locus:2153704682 AT5G06050 [Arabidopsis thalian 0.779 0.353 0.403 3.5e-52
TAIR|locus:2195955655 AT1G77260 [Arabidopsis thalian 0.786 0.370 0.399 4e-51
TAIR|locus:2129660608 AT4G14360 [Arabidopsis thalian 0.776 0.394 0.428 8.5e-49
TAIR|locus:2063078 AT2G40280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 938 (335.3 bits), Expect = 3.0e-94, P = 3.0e-94
 Identities = 169/269 (62%), Positives = 203/269 (75%)

Query:    40 MVNLTESMCWKAVARSVDSNRIGFVIYQKPVSYSCYKNREENTPPLCDGKNNLNSSWHVP 99
             MV+LT+S+CWK V ++VDS+ IG VIYQKP S SCY  R    PPLCD K   N SW+VP
Sbjct:   323 MVSLTKSICWKVVTKTVDSSGIGLVIYQKPTSESCYNKRSTQDPPLCD-KKEANGSWYVP 381

Query:   100 LSNCISRLPTDSKGNLHSWPAPWPQRXXXXXXXXXXXXEEAFNKDTTHWYALVSDVYVGG 159
             L+ C+S+LP+   GN+ SWP  WP+R             E   KDT  W A VSDVY+  
Sbjct:   382 LAKCLSKLPS---GNVQSWPELWPKRLVSVKPQSISVKAETLKKDTEKWSASVSDVYLKH 438

Query:   160 LAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRGLIGMYHDWC 219
             LA+NWS+VRNVMDMNA +GGFAAALI+ PLWVMNVVP+D PDTLS+++DRGLIG+YHDWC
Sbjct:   439 LAVNWSTVRNVMDMNAGFGGFAAALINLPLWVMNVVPVDKPDTLSVVYDRGLIGVYHDWC 498

Query:   220 ESFNTYPRTYDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTLEMINKLKPV 279
             ES NTYPRTYDLLHSSFLL D+TQRC+I  V  E+DRI+RPGGY++VQD +E I KL+ +
Sbjct:   499 ESVNTYPRTYDLLHSSFLLGDLTQRCEIVQVVAEIDRIVRPGGYLVVQDNMETIMKLESI 558

Query:   280 LHSLQWSTNIYHDQFLVGKKGFWRPTGGE 308
             L SL WST IY D+FLVG+KGFWRP   E
Sbjct:   559 LGSLHWSTKIYEDRFLVGRKGFWRPAKPE 587




GO:0005794 "Golgi apparatus" evidence=ISM;IDA
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2013628 AT1G29470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040864 AT2G34300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160806 AT5G64030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080823 AT3G51070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016392 AT1G19430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063947 AT2G39750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153704 AT5G06050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195955 AT1G77260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129660 AT4G14360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00029349001
SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (606 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
pfam03141506 pfam03141, Methyltransf_29, Putative S-adenosyl-L- 1e-122
pfam03141 506 pfam03141, Methyltransf_29, Putative S-adenosyl-L- 3e-04
>gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information
 Score =  359 bits (923), Expect = e-122
 Identities = 127/260 (48%), Positives = 172/260 (66%), Gaps = 12/260 (4%)

Query: 38  AAMVNLTESMCWKAVARSVDSNRIGFVIYQKPVSYSCYKNRE-ENTPPLCDGKNNLNSSW 96
            AM  L +S+CWK VA+  D       I+QKPV+ SCY  RE    PPLC   ++ +++W
Sbjct: 235 KAMEALAKSLCWKLVAKKGD-----IAIWQKPVNNSCYNKREPGKKPPLCKDSDDPDAAW 289

Query: 97  HVPLSNCISRLPTDSKGNLHSWPAPWPQRLSSKPPSL-----PPDSEEAFNKDTTHWYAL 151
           +VP+  CI+ LP  S      W   WP+RL++ PP L        S EAF  DT  W   
Sbjct: 290 YVPMEACITPLPEVSHEVGGGWLEKWPERLTAVPPRLASGQIGGVSAEAFKADTELWKRR 349

Query: 152 VSDVY-VGGLAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRG 210
           VS    +  L I+   VRNVMDMNA +GGFAAALID P+WVMNVVP+D+PDTL +I+DRG
Sbjct: 350 VSKYKRLLKLLIDKGRVRNVMDMNAGFGGFAAALIDDPVWVMNVVPVDSPDTLPVIYDRG 409

Query: 211 LIGMYHDWCESFNTYPRTYDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTL 270
           LIG+YHDWCE F+TYPRTYDLLH+  L S   +RC++ D+ +EMDRILRPGG V+++D +
Sbjct: 410 LIGIYHDWCEPFSTYPRTYDLLHADHLFSLYKKRCNLEDILLEMDRILRPGGAVIIRDDV 469

Query: 271 EMINKLKPVLHSLQWSTNIY 290
           ++++K+K +  +++W   I 
Sbjct: 470 DVLDKVKKIAKAMRWEVRIT 489


This family is a putative S-adenosyl-L-methionine (SAM)-dependent methyltransferase. Length = 506

>gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 309
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 100.0
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 100.0
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.69
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.64
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.64
PLN02233261 ubiquinone biosynthesis methyltransferase 99.55
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.44
PRK05785226 hypothetical protein; Provisional 99.42
PLN02244340 tocopherol O-methyltransferase 99.42
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.4
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.39
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.38
PRK11207197 tellurite resistance protein TehB; Provisional 99.38
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.37
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.35
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.34
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.33
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.31
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.3
PLN02336475 phosphoethanolamine N-methyltransferase 99.27
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.27
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.26
TIGR00452314 methyltransferase, putative. Known examples to dat 99.26
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.25
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.25
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.23
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.23
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.23
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.23
PRK08317241 hypothetical protein; Provisional 99.22
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.22
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.22
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.22
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.21
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.21
PLN02336 475 phosphoethanolamine N-methyltransferase 99.19
PLN02490340 MPBQ/MSBQ methyltransferase 99.17
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.16
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.14
PRK12335287 tellurite resistance protein TehB; Provisional 99.13
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.13
PRK06202232 hypothetical protein; Provisional 99.12
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.11
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.09
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.07
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.07
PRK06922677 hypothetical protein; Provisional 99.07
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.05
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.05
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.03
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.02
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.02
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.01
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.0
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.0
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.99
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.99
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.98
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.97
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.95
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.95
TIGR00438188 rrmJ cell division protein FtsJ. 98.94
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.93
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.92
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.91
PRK04266226 fibrillarin; Provisional 98.9
PRK14968188 putative methyltransferase; Provisional 98.88
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.87
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.87
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.86
COG4106257 Tam Trans-aconitate methyltransferase [General fun 98.84
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.83
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.82
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.82
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.8
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.76
KOG3010261 consensus Methyltransferase [General function pred 98.76
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.74
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.73
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.73
PTZ00146293 fibrillarin; Provisional 98.72
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.72
KOG4300252 consensus Predicted methyltransferase [General fun 98.71
PRK14967223 putative methyltransferase; Provisional 98.71
PLN02232160 ubiquinone biosynthesis methyltransferase 98.71
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.7
TIGR03438301 probable methyltransferase. This model represents 98.69
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.69
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 98.68
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.68
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.67
KOG2361264 consensus Predicted methyltransferase [General fun 98.66
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.64
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.62
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.61
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.6
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.58
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.58
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.58
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.56
PRK07402196 precorrin-6B methylase; Provisional 98.53
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.53
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.52
COG4123248 Predicted O-methyltransferase [General function pr 98.5
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.48
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.47
PLN03075296 nicotianamine synthase; Provisional 98.46
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.45
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.43
COG2890280 HemK Methylase of polypeptide chain release factor 98.4
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.39
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.38
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.37
KOG3045325 consensus Predicted RNA methylase involved in rRNA 98.32
PRK04457262 spermidine synthase; Provisional 98.3
PRK10901427 16S rRNA methyltransferase B; Provisional 98.3
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.29
PRK00811283 spermidine synthase; Provisional 98.27
PRK14902444 16S rRNA methyltransferase B; Provisional 98.27
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.27
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.25
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 98.22
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.21
PRK14901434 16S rRNA methyltransferase B; Provisional 98.21
PRK01581374 speE spermidine synthase; Validated 98.2
PRK14904445 16S rRNA methyltransferase B; Provisional 98.19
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.19
PRK14903431 16S rRNA methyltransferase B; Provisional 98.19
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.15
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.13
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.1
KOG2940 325 consensus Predicted methyltransferase [General fun 98.09
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 98.08
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 98.07
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.06
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.05
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 98.04
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.04
PHA03411279 putative methyltransferase; Provisional 98.01
PRK03612521 spermidine synthase; Provisional 98.01
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.0
KOG1271227 consensus Methyltransferases [General function pre 97.97
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 97.96
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.96
PLN02366308 spermidine synthase 97.95
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 97.94
KOG1269 364 consensus SAM-dependent methyltransferases [Lipid 97.88
KOG1331 293 consensus Predicted methyltransferase [General fun 97.88
smart00650169 rADc Ribosomal RNA adenine dimethylases. 97.87
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 97.83
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 97.81
PHA03412241 putative methyltransferase; Provisional 97.8
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.77
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 97.71
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.68
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 97.68
PLN02476278 O-methyltransferase 97.66
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 97.6
COG4122219 Predicted O-methyltransferase [General function pr 97.6
PLN02672 1082 methionine S-methyltransferase 97.57
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.57
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 97.48
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 97.48
COG2521287 Predicted archaeal methyltransferase [General func 97.46
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 97.41
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 97.41
KOG2899288 consensus Predicted methyltransferase [General fun 97.4
KOG2904328 consensus Predicted methyltransferase [General fun 97.39
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 97.38
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.34
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 97.27
COG4627185 Uncharacterized protein conserved in bacteria [Fun 97.25
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 97.2
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 97.15
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.15
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.11
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 97.07
PRK04148134 hypothetical protein; Provisional 97.06
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.0
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 96.92
PLN02589247 caffeoyl-CoA O-methyltransferase 96.84
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 96.81
PLN02823336 spermine synthase 96.77
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.77
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.7
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 96.68
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 96.5
PRK00536262 speE spermidine synthase; Provisional 96.43
COG1041347 Predicted DNA modification methylase [DNA replicat 96.36
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 96.28
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 96.03
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 96.01
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 95.96
COG1092393 Predicted SAM-dependent methyltransferases [Genera 95.94
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 95.93
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 95.93
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 95.92
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 95.9
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 95.88
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 95.73
PRK13699 227 putative methylase; Provisional 95.54
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 95.52
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 95.41
KOG3115249 consensus Methyltransferase-like protein [General 95.23
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 95.2
COG4798238 Predicted methyltransferase [General function pred 95.19
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 95.03
KOG3987288 consensus Uncharacterized conserved protein DREV/C 94.98
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 94.89
COG2263198 Predicted RNA methylase [Translation, ribosomal st 94.86
PF03269177 DUF268: Caenorhabditis protein of unknown function 94.64
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 94.64
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 94.59
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 94.52
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 94.43
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 94.4
KOG1663237 consensus O-methyltransferase [Secondary metabolit 94.23
PRK11524 284 putative methyltransferase; Provisional 94.19
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 94.16
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 94.08
COG0421282 SpeE Spermidine synthase [Amino acid transport and 94.05
PLN02668 386 indole-3-acetate carboxyl methyltransferase 93.73
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 93.65
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 93.58
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 93.21
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 93.14
KOG3201201 consensus Uncharacterized conserved protein [Funct 93.01
KOG2352 482 consensus Predicted spermine/spermidine synthase [ 92.6
KOG1709271 consensus Guanidinoacetate methyltransferase and r 92.54
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 92.04
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 91.79
COG2265432 TrmA SAM-dependent methyltransferases related to t 91.75
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 91.57
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 91.24
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 91.11
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 90.9
PF13679141 Methyltransf_32: Methyltransferase domain 90.75
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 89.86
PF03492 334 Methyltransf_7: SAM dependent carboxyl methyltrans 89.44
KOG2539 491 consensus Mitochondrial/chloroplast ribosome small 89.02
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 89.02
COG3897218 Predicted methyltransferase [General function pred 88.53
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 88.36
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 88.26
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 88.1
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 86.21
PF01555 231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 86.07
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 85.94
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 85.77
COG0742187 N6-adenine-specific methylase [DNA replication, re 85.54
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 85.49
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 82.8
KOG1099294 consensus SAM-dependent methyltransferase/cell div 81.57
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
Probab=100.00  E-value=6.5e-85  Score=646.00  Aligned_cols=278  Identities=48%  Similarity=0.933  Sum_probs=261.7

Q ss_pred             cceeeeeecccCCCc---------------hhhHHHHHHHHHHHHhcchhhhhhhcCCCceeEEEEEcCCCCchhccccC
Q 021643           16 NLSYGLECCNLSSFN---------------VHIRFSLAAMVNLTESMCWKAVARSVDSNRIGFVIYQKPVSYSCYKNREE   80 (309)
Q Consensus        16 ~~~~~~~~~~~~~~~---------------~~~~~~w~~~~~l~~~~Cw~~~~~~~~~~~~~~~iw~Kp~~~~C~~~r~~   80 (309)
                      .++||+|+||+|||+               .+..++|++|++||++|||++|++++|     +||||||.+|+||.+|+.
T Consensus       198 ~g~~l~evdRvLRpGGyfv~S~ppv~~r~~~~~~~~~~~~~~l~~~lCW~~va~~~~-----~aIwqKp~~~~Cy~~r~~  272 (506)
T PF03141_consen  198 DGFLLFEVDRVLRPGGYFVLSGPPVYQRTDEDLEEEWNAMEDLAKSLCWKKVAEKGD-----TAIWQKPTNNSCYQKRKP  272 (506)
T ss_pred             ccceeehhhhhhccCceEEecCCcccccchHHHHHHHHHHHHHHHHHHHHHheeeCC-----EEEEeccCCchhhhhccC
Confidence            589999999999993               246789999999999999999999998     999999999999999986


Q ss_pred             -CCCCCCCCCCCCCCcccccCCCccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CchhhhcccchhHHHHHHH
Q 021643           81 -NTPPLCDGKNNLNSSWHVPLSNCISRLPTDSKGNLHSWPAPWPQRLSSKPPSLPP-----DSEEAFNKDTTHWYALVSD  154 (309)
Q Consensus        81 -~~p~~C~~~~~~~~~wy~~~~~Cl~p~P~~~~~~~~~~p~~WP~rl~~~p~~l~~-----~~~e~F~~d~~~W~~~v~~  154 (309)
                       ..||+|++++|||++||+||++||+|+|+......++++.+||+||+++|+||+.     .+.|.|.+|+++|+++|.+
T Consensus       273 ~~~pplC~~~~dpd~aWY~~l~~Cit~~p~~~~~~~~~~~~~WP~RL~~~P~rl~~~~~~g~~~e~F~~Dt~~Wk~~V~~  352 (506)
T PF03141_consen  273 GKSPPLCDSSDDPDAAWYVPLEACITPLPEVSSEIAGGWLPKWPERLNAVPPRLSSGSIPGISPEEFKEDTKHWKKRVSH  352 (506)
T ss_pred             CCCCCCCCCCCCCcchhhcchhhhcCcCCcccccccccCCCCChhhhccCchhhhcCCcCCCCHHHHHHHHHHHHHHHHH
Confidence             7899999888999999999999999999975555567899999999999999987     5889999999999999997


Q ss_pred             HHHhc--cCCCCCCCCeEEEeCCcchHHHHHhhcCCCEEEEecccCCcccHHHHHhcCcchhhhhccccCCCCCCCccee
Q 021643          155 VYVGG--LAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAPDTLSIIFDRGLIGMYHDWCESFNTYPRTYDLL  232 (309)
Q Consensus       155 ~y~~~--l~i~~~~~r~VLD~GCG~G~faa~L~~~~v~v~~V~p~d~s~~l~~a~eRglig~~~d~ce~~lpfP~sFDlV  232 (309)
                       |...  +.+.++++||||||++|+|||||+|.+++||||||+|+..+++|+++++|||+|+||||||++++||||||||
T Consensus       353 -Y~~l~~~~i~~~~iRNVMDMnAg~GGFAAAL~~~~VWVMNVVP~~~~ntL~vIydRGLIG~yhDWCE~fsTYPRTYDLl  431 (506)
T PF03141_consen  353 -YKKLLGLAIKWGRIRNVMDMNAGYGGFAAALIDDPVWVMNVVPVSGPNTLPVIYDRGLIGVYHDWCEAFSTYPRTYDLL  431 (506)
T ss_pred             -HHHhhcccccccceeeeeeecccccHHHHHhccCCceEEEecccCCCCcchhhhhcccchhccchhhccCCCCcchhhe
Confidence             5543  4588899999999999999999999999999999999988899999999999999999999999999999999


Q ss_pred             EeccccccccccCCHHHHHHHHhhcccCCeEEEEEeCHHHHHHHHHHHHcCCCeeeee--------cceEEEEEe
Q 021643          233 HSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQDTLEMINKLKPVLHSLQWSTNIY--------HDQFLVGKK  299 (309)
Q Consensus       233 h~~~v~~~~~~~~~~~~~L~Em~RVLRPGG~lii~D~~~~~~~i~~l~~~l~W~~~~~--------~e~~li~~K  299 (309)
                      |++++|+++.++|+++++|.||||||||||++||+|..+++++|++|+++|||++.+.        +|++|||||
T Consensus       432 HA~~lfs~~~~rC~~~~illEmDRILRP~G~~iiRD~~~vl~~v~~i~~~lrW~~~~~d~e~g~~~~EkiL~~~K  506 (506)
T PF03141_consen  432 HADGLFSLYKDRCEMEDILLEMDRILRPGGWVIIRDTVDVLEKVKKIAKSLRWEVRIHDTEDGPDGPEKILICQK  506 (506)
T ss_pred             ehhhhhhhhcccccHHHHHHHhHhhcCCCceEEEeccHHHHHHHHHHHHhCcceEEEEecCCCCCCCceEEEEEC
Confidence            9999999999999999999999999999999999999999999999999999999887        699999998



; GO: 0008168 methyltransferase activity

>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>KOG2539 consensus Mitochondrial/chloroplast ribosome small subunit component [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query309
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.54
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.5
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.5
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.5
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.5
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.5
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.49
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.49
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.49
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.49
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.48
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.48
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.46
3cc8_A230 Putative methyltransferase; structural genomics, j 99.46
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.46
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.45
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.45
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.45
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.44
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.44
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.44
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.44
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.44
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.43
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.43
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.43
3ocj_A305 Putative exported protein; structural genomics, PS 99.42
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.42
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.42
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.42
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.42
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.41
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.41
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.4
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.4
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.4
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.4
3f4k_A257 Putative methyltransferase; structural genomics, P 99.4
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.4
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.4
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.39
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.39
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.39
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.39
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.39
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.39
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 99.39
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.39
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.38
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.37
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.36
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.36
3lcc_A235 Putative methyl chloride transferase; halide methy 99.36
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.35
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.35
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.35
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.34
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.34
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.34
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.34
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.34
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.33
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.33
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.32
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.32
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.32
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.32
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.32
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.31
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.3
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.3
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.29
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 99.29
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.28
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.28
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.28
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.27
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.27
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.27
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.27
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.26
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.26
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.26
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.26
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 99.25
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.25
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.22
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.21
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.2
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.2
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.19
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.19
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.18
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.18
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.17
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.17
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.17
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.16
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.16
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 99.15
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.15
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.15
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.15
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.14
3lpm_A259 Putative methyltransferase; structural genomics, p 99.14
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.14
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.14
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 99.13
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.13
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.13
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.13
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.13
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.12
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.11
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.11
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.1
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.1
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.09
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.09
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.08
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.08
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.08
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 99.07
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.07
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 99.07
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.06
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.06
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.05
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 99.05
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.05
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.04
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.03
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.03
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.03
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.02
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.02
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.02
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.01
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 99.01
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.01
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.01
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.01
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.0
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.0
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.99
1ws6_A171 Methyltransferase; structural genomics, riken stru 98.99
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.99
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.99
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.99
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.99
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.99
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.98
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.97
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.96
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 98.95
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.95
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.94
2esr_A177 Methyltransferase; structural genomics, hypothetic 98.94
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.94
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.94
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.93
2fpo_A202 Methylase YHHF; structural genomics, putative meth 98.93
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.93
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.92
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.91
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.9
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.9
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.9
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.89
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.88
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 98.88
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 98.88
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.88
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.87
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.86
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.86
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.85
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.85
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.84
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.84
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.84
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 98.84
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.84
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.84
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.83
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.81
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.81
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.81
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.81
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.8
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.79
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.79
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.78
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.77
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.76
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.75
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.75
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.74
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.74
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.73
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.73
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.71
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.71
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.71
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.71
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.7
2o07_A304 Spermidine synthase; structural genomics, structur 98.7
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.7
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.69
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.69
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.68
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.68
2pt6_A321 Spermidine synthase; transferase, structural genom 98.66
2b25_A336 Hypothetical protein; structural genomics, methyl 98.66
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.64
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.63
2h00_A254 Methyltransferase 10 domain containing protein; st 98.62
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.61
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.61
2i7c_A283 Spermidine synthase; transferase, structural genom 98.6
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.59
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.54
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.5
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.49
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 98.49
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.47
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.45
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.43
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.42
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.42
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.4
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.39
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.39
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.38
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.37
3k6r_A278 Putative transferase PH0793; structural genomics, 98.36
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.36
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.35
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.35
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.35
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.34
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 98.32
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.32
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.29
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.2
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.19
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.16
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.15
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.15
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.13
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 98.12
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 98.1
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 98.05
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.04
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 98.01
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 97.98
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 97.81
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 97.57
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 97.52
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 97.47
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 97.4
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 97.37
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 97.35
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 97.34
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 97.32
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 97.23
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 97.23
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 97.09
3fut_A271 Dimethyladenosine transferase; methyltransferase, 97.09
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 97.07
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 97.03
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 96.96
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 96.89
3ll7_A 410 Putative methyltransferase; methytransferase, stru 96.82
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 96.77
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 96.73
3khk_A 544 Type I restriction-modification system methylation 96.71
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 96.7
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 96.69
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 96.6
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 96.52
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 96.26
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 96.0
3cvo_A202 Methyltransferase-like protein of unknown functio; 95.88
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 95.87
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 95.72
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 95.62
2px2_A269 Genome polyprotein [contains: capsid protein C (co 95.38
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 95.23
3lkd_A 542 Type I restriction-modification system methyltrans 95.13
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 95.05
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 94.59
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 93.72
2zig_A 297 TTHA0409, putative modification methylase; methylt 93.2
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 93.17
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 92.91
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 92.59
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 91.3
2zig_A297 TTHA0409, putative modification methylase; methylt 90.77
1eg2_A 319 Modification methylase RSRI; rossmann fold, exocyc 88.12
1g60_A 260 Adenine-specific methyltransferase MBOIIA; structu 86.0
4dcm_A 375 Ribosomal RNA large subunit methyltransferase G; 2 84.6
3ufb_A 530 Type I restriction-modification system methyltran 83.55
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 83.12
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 81.61
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 81.49
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
Probab=99.54  E-value=2.8e-15  Score=137.72  Aligned_cols=93  Identities=14%  Similarity=0.143  Sum_probs=72.2

Q ss_pred             CeEEEeCCcchHHHHHhhcCCCEEEEecccCCc-ccHHHHHhcCcchhhhhccccCCCCC-CCcceeEeccccccccccC
Q 021643          168 RNVMDMNASYGGFAAALIDQPLWVMNVVPIDAP-DTLSIIFDRGLIGMYHDWCESFNTYP-RTYDLLHSSFLLSDVTQRC  245 (309)
Q Consensus       168 r~VLD~GCG~G~faa~L~~~~v~v~~V~p~d~s-~~l~~a~eRglig~~~d~ce~~lpfP-~sFDlVh~~~v~~~~~~~~  245 (309)
                      .+|||+|||+|.++..|++++.   +|+++|.+ .|++.+.++.-+...+.-.| .+||| ++||+|+|..++||..   
T Consensus        41 ~~vLDvGcGtG~~~~~l~~~~~---~v~gvD~s~~ml~~a~~~~~v~~~~~~~e-~~~~~~~sfD~v~~~~~~h~~~---  113 (257)
T 4hg2_A           41 GDALDCGCGSGQASLGLAEFFE---RVHAVDPGEAQIRQALRHPRVTYAVAPAE-DTGLPPASVDVAIAAQAMHWFD---  113 (257)
T ss_dssp             SEEEEESCTTTTTHHHHHTTCS---EEEEEESCHHHHHTCCCCTTEEEEECCTT-CCCCCSSCEEEEEECSCCTTCC---
T ss_pred             CCEEEEcCCCCHHHHHHHHhCC---EEEEEeCcHHhhhhhhhcCCceeehhhhh-hhcccCCcccEEEEeeehhHhh---
Confidence            5899999999999999999875   45677777 68877765432221221122 58999 9999999999996653   


Q ss_pred             CHHHHHHHHhhcccCCeEEEEEe
Q 021643          246 DIADVAVEMDRILRPGGYVLVQD  268 (309)
Q Consensus       246 ~~~~~L~Em~RVLRPGG~lii~D  268 (309)
                       .+.++.|+.|||||||.|++.+
T Consensus       114 -~~~~~~e~~rvLkpgG~l~~~~  135 (257)
T 4hg2_A          114 -LDRFWAELRRVARPGAVFAAVT  135 (257)
T ss_dssp             -HHHHHHHHHHHEEEEEEEEEEE
T ss_pred             -HHHHHHHHHHHcCCCCEEEEEE
Confidence             6789999999999999998864



>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 309
d1tw3a2253 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransf 0.003
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 253 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Carminomycin 4-O-methyltransferase
species: Streptomyces peucetius [TaxId: 1950]
 Score = 36.2 bits (82), Expect = 0.003
 Identities = 29/137 (21%), Positives = 46/137 (33%), Gaps = 5/137 (3%)

Query: 135 PDSEEAFNKDTTHWYALVSDVYVGGLAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNV 194
           PD   +F+        +  D      A +W++VR+V+D+    GGFAAA+  +   V   
Sbjct: 51  PDLRASFDSLLACDQDVAFDAPAA--AYDWTNVRHVLDVGGGKGGFAAAIARRAPHVSAT 108

Query: 195 V---PIDAPDTLSIIFDRGLIGMYHDWCESFNTYPRTYDLLHSSFLLSDVTQRCDIADVA 251
           V           S + D GL          F               +       D   + 
Sbjct: 109 VLEMAGTVDTARSYLKDEGLSDRVDVVEGDFFEPLPRKADAIILSFVLLNWPDHDAVRIL 168

Query: 252 VEMDRILRPGGYVLVQD 268
                 L PGG +L+ +
Sbjct: 169 TRCAEALEPGGRILIHE 185


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query309
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.67
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.66
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.65
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.63
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.6
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.59
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.55
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.51
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.5
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.5
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.5
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.49
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.49
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.49
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.46
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.45
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.43
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.42
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.42
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.42
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.42
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.38
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.38
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.38
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.37
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.36
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.3
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.29
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.24
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.19
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.19
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.13
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.11
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.08
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.08
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.06
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.03
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.02
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.02
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.01
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.98
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 98.85
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.84
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.82
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.72
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.69
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 98.69
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.67
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.6
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.55
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.54
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.53
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.37
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.35
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.34
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.26
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.13
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.11
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.1
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.08
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.08
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.07
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.06
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 97.99
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 97.94
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 97.93
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 97.84
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 97.68
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 97.66
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 97.63
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.61
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.38
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.28
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 97.26
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.22
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 97.21
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 97.13
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 97.04
d2h00a1250 Methyltransferase 10 domain containing protein MET 96.94
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 96.75
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 96.72
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 96.17
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 96.09
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 96.08
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 95.76
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 95.71
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 95.64
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 95.57
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 95.36
d1g60a_ 256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 95.15
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 95.11
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 94.46
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 94.42
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 92.99
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 92.88
d1m6ex_ 359 Salicylic acid carboxyl methyltransferase (SAMT) { 91.76
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 91.36
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 90.18
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 89.0
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 88.8
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 88.24
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 88.14
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 87.56
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 87.26
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 85.4
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 81.97
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 81.65
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 80.78
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein BH2331
species: Bacillus halodurans [TaxId: 86665]
Probab=99.67  E-value=2.6e-17  Score=142.84  Aligned_cols=103  Identities=20%  Similarity=0.251  Sum_probs=78.8

Q ss_pred             HhccCCCCCCCCeEEEeCCcchHHHHHhhcCCCEEEEecccCCc-ccHHHHHhc----Cc--chhhhhccccCCCCC-CC
Q 021643          157 VGGLAINWSSVRNVMDMNASYGGFAAALIDQPLWVMNVVPIDAP-DTLSIIFDR----GL--IGMYHDWCESFNTYP-RT  228 (309)
Q Consensus       157 ~~~l~i~~~~~r~VLD~GCG~G~faa~L~~~~v~v~~V~p~d~s-~~l~~a~eR----gl--ig~~~d~ce~~lpfP-~s  228 (309)
                      ++..++..  ..+|||+|||+|.++..|++.+.   .++++|.+ ++++.|.++    |.  +......++ .+||| ++
T Consensus         8 l~~~~l~~--~~rVLDiGcG~G~~~~~l~~~~~---~v~gvD~s~~~i~~A~~~~~~~~~~~i~~~~~d~~-~l~~~~~~   81 (231)
T d1vl5a_           8 MQIAALKG--NEEVLDVATGGGHVANAFAPFVK---KVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDAE-QMPFTDER   81 (231)
T ss_dssp             HHHHTCCS--CCEEEEETCTTCHHHHHHGGGSS---EEEEEESCHHHHHHHHHHHHHTTCCSEEEEECCC--CCCSCTTC
T ss_pred             HHhcCCCC--cCEEEEecccCcHHHHHHHHhCC---EEEEEECCHHHHhhhhhcccccccccccccccccc-cccccccc
Confidence            33444544  35899999999999999998865   45677877 688877654    33  222222223 58999 99


Q ss_pred             cceeEeccccccccccCCHHHHHHHHhhcccCCeEEEEEe
Q 021643          229 YDLLHSSFLLSDVTQRCDIADVAVEMDRILRPGGYVLVQD  268 (309)
Q Consensus       229 FDlVh~~~v~~~~~~~~~~~~~L~Em~RVLRPGG~lii~D  268 (309)
                      ||+|+|..+++|+.+   ++.+|.|+.|+|||||+++|.+
T Consensus        82 fD~v~~~~~l~~~~d---~~~~l~~~~r~LkpgG~l~i~~  118 (231)
T d1vl5a_          82 FHIVTCRIAAHHFPN---PASFVSEAYRVLKKGGQLLLVD  118 (231)
T ss_dssp             EEEEEEESCGGGCSC---HHHHHHHHHHHEEEEEEEEEEE
T ss_pred             cccccccccccccCC---HHHHHHHHHHhcCCCcEEEEEe
Confidence            999999999999864   7889999999999999999975



>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure