Citrus Sinensis ID: 021648


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MEVGMSFRDYNGRISSMDFHKSSSYLVTASDDESIRLYDVTAATCLKTINSKKYGVDLVCFTSHPTTVIYSSKNGWDESLRLLSLHDNKYLRYFKGHHDRVVSLSLCSSKDCFISGSLDRTVLLWDQRAEKCQGLLRVQGRPAAAYDDQGLVFAVAFGGYIRMFDARKYEKGPFDIFSVGGDISDANVVKFSNDGRLMLLTTMEGHIHVLDSFRGTLLSTYNVKPVSRNSTLEASFSPEGMFVISGSGDGSVYAWSVRSGKEVASWMSFDTEPPVIKWTPGSLMFVTGSSELSFWIPDLSKLGAYVGRK
cCEccEEccccccEEEEEEcccccEEEEECccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEcccccccEEEEEEccccEEEEEEccccccEEEEEEcccccEEEECcccccEEEEEcccccEEEEEECccCEEEECccccEEEEEEccccEEEEEcccccccccEEEccccccccEEEEEEcccccEEEEEEccccEEEEEccccCEEEEEEccccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEccccccccEEEEEcccccEEEEcccccEEEcccccccccccccc
MEVGMSFRDYNGRISSMDFHKSSSYLVTASDDESIRLYDVTAATCLKTINSKKYGVDLVCFTSHPTTVIYSSKNGWDESLRLLSLHDNKYLRYFKGHHDRVVSLSLCSSKDCFISGSLDRTVLLWDQRAEKCQGLLRVQGRPAAAYDDQGLVFAVAFGGYIRMFDARKYEKGPFDIFSVGGDISDANVVKFSNDGRLMLLTTMEGHIHVLDSFRGTLLSTYNVKPVSRNSTLEASFSPEGMFVISGSGDGSVYAWSVRSGKEVASWMSFDTEPPVIKWTPGSLMFVTGSSELSFWIPDLSKLGA*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVGMSFRDYNGRISSMDFHKSSSYLVTASDDESIRLYDVTAATCLKTINSKKYGVDLVCFTSHPTTVIYSSKNGWDESLRLLSLHDNKYLRYFKGHHDRVVSLSLCSSKDCFISGSLDRTVLLWDQRAEKCQGLLRVQGRPAAAYDDQGLVFAVAFGGYIRMFDARKYEKGPFDIFSVGGDISDANVVKFSNDGRLMLLTTMEGHIHVLDSFRGTLLSTYNVKPVSRNSTLEASFSPEGMFVISGSGDGSVYAWSVRSGKEVASWMSFDTEPPVIKWTPGSLMFVTGSSELSFWIPDLSKLGAYVGRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat-containing protein 82 Regulatory component of the SET1 complex implicated in the tethering of this complex to transcriptional start sites of active genes. Facilitates histone H3 'Lys-4' methylation via recruitment of the SETD1A or SETD1B to the 'Ser-5' phosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Component of PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Possible role in telomere length maintenance and in mRNA processing.probableQ8BFQ4
WD repeat-containing protein 82 Component of a chromatin regulatory complex involved in regulating chromatin structure in the nucleus.probableQ5ZMV7
COMPASS component SWD2 Involved in mediating RNA polymerase II termination. Component of the cleavage and polyadenylation factor (CPF) complex, which plays a key role in polyadenylation-dependent pre-mRNA 3'-end formation and cooperates with cleavage factors including the CFIA complex and NAB4/CFIB. Component of the APT complex, which may be involved in polyadenylation-independent transcript 3'-end formation.probableP36104

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PBI, chain B
Confidence level:very confident
Coverage over the Query: 3-256
View the alignment between query and template
View the model in PyMOL
Template: 2PBI, chain B
Confidence level:very confident
Coverage over the Query: 2-297
View the alignment between query and template
View the model in PyMOL