Citrus Sinensis ID: 021651

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MLQNSASSQIGAAGSDPLLNKVSAFRDACWRFLRPHTIRGTALGSVALVARALIENPNLIKWSLLLKAFSGLLALICGNGYIVGINQIYDIGIDKVNKPYLPIAAGDLSVQSAWFLVIFFAVTGLLIVAFNFGPFITSLYCLGLFLGTIYSVPPFRMKRFAVAAFLIIATVRGFLLNFGVYYATRAALGLSFEWNAPVAFITAFVTLFALVIAVTKDLPDVEGDRKFKISTLATKLGVKNIAFLGSGLLLLNYVAAILAAIYMPQAFRRNLMIPAHVILASCLLFQTWLLERANYTKVILATCCTLGMW
ccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccCCcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccc
******************LNKVSAFRDACWRFLRPHTIRGTALGSVALVARALIENPNLIKWSLLLKAFSGLLALICGNGYIVGINQIYDIGIDKVNKPYLPIAAGDLSVQSAWFLVIFFAVTGLLIVAFNFGPFITSLYCLGLFLGTIYSVPPFRMKRFAVAAFLIIATVRGFLLNFGVYYATRAALGLSFEWNAPVAFITAFVTLFALVIAVTKDLPDVEGDRKFKISTLATKLGVKNIAFLGSGLLLLNYVAAILAAIYMPQAFRRNLMIPAHVILASCLLFQTWLLERANYTKVILATCCTLGMW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQNSASSQIGAAGSDPLLNKVSAFRDACWRFLRPHTIRGTALGSVALVARALIENPNLIKWSLLLKAFSGLLALICGNGYIVGINQIYDIGIDKVNKPYLPIAAGDLSVQSAWFLVIFFAVTGLLIVAFNFGPFITSLYCLGLFLGTIYSVPPFRMKRFAVAAFLIIATVRGFLLNFGVYYATRAALGLSFEWNAPVAFITAFVTLFALVIAVTKDLPDVEGDRKFKISTLATKLGVKNIAFLGSGLLLLNYVAAILAAIYMPQAFRRNLMIPAHVILASCLLFQTWLLERANYTKVILATCCTLGMW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable homogentisate phytyltransferase 2, chloroplastic Involved in the synthesis of tocopherol (vitamin E). Catalyzes the condensation of homogentisate and phytyl diphosphate to form dimethylphytylhydrquinone.probableQ0D576
Homogentisate phytyltransferase 2, chloroplastic Involved in the synthesis of tocopherol (vitamin E). Catalyzes the condensation of homogentisate and phytyl diphosphate to form dimethylphytylhydrquinone.probableQ1ACB3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!