Citrus Sinensis ID: 021756


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MNRGIEILSPASYLENSNWLFQESKGTKWTPQENKQFENALAVYDKDTPDRWIKVAAMIPGKTVGDVIKQYKELEEDVSDIEAGLIPIPGYGNDSFTLEWVDSNQGYDGLKNFYGPGGKRGSSTRPSDQERKKGVPWTEEEHRQFLMGLKKFGKGDWRNISRNFVTTRTPTQVASHAQKYFNRQLTGGKDKRRSSIHDITTVNLDETATSSSENNKPPSPSPSAAVIQLQQQPKTVDMSNEQFNWKSQNEGTAMLFNSMNGTAFMAPFCGISSYGPKLQEQNLLGGNLNGSQFGAYSAYFQMQSMQHQ
cccccEEcccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccc
**RGIEILSPASYLENSNWLFQE****KW****NKQFENALAVYDKDTPDRWIKVAAMIPGKTVGDVIKQYKELEEDVSDIEAGLIPIPGYGNDSFTLEWVDSNQGYD*****************************TEEEHRQFLMGLKKFGKGDWRNISRNFVTTRTPTQVASHAQKYF*******************************************************************************GTAFMAPFCGISSYGPKLQEQNLLGGNLNGSQFGAYSAYF*M******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRGIEILSPASYLENSNWLFQESKGTKWTPQENKQFENALAVYDKDTPDRWIKVAAMIPGKTVGDVIKQYKELEEDVSDIEAGLIPIPGYGNDSFTLEWVDSNQGYDGLKNFYGPGGKRGSSTRPSDQERKKGVPWTEEEHRQFLMGLKKFGKGDWRNISRNFVTTRTPTQVASHAQKYFNRQLTGGKDKRRSSIHDITTVNLDETATSSSENNKPPSPSPSAAVIQLQQQPKTVDMSNEQFNWKSQNEGTAMLFNSMNGTAFMAPFCGISSYGPKLQEQNLLGGNLNGSQFGAYSAYFQMQSMQHQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor DIVARICATA Involved in the dorsovental asymmetry of flowers. Promotes ventral identity.probableQ8S9H7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CU7, chain A
Confidence level:very confident
Coverage over the Query: 133-198
View the alignment between query and template
View the model in PyMOL
Template: 2CU7, chain A
Confidence level:very confident
Coverage over the Query: 22-77
View the alignment between query and template
View the model in PyMOL
Template: 1OFC, chain X
Confidence level:confident
Coverage over the Query: 27-108,131-182
View the alignment between query and template
View the model in PyMOL