Citrus Sinensis ID: 021756
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 308 | ||||||
| 224087718 | 307 | predicted protein [Populus trichocarpa] | 0.996 | 1.0 | 0.756 | 1e-134 | |
| 255588751 | 307 | DNA binding protein, putative [Ricinus c | 0.990 | 0.993 | 0.748 | 1e-133 | |
| 51557078 | 310 | MYB transcription factor [Hevea brasilie | 0.996 | 0.990 | 0.720 | 1e-125 | |
| 12005328 | 310 | unknown [Hevea brasiliensis] | 0.996 | 0.990 | 0.717 | 1e-124 | |
| 84314023 | 310 | MYB transcription factor [Hevea brasilie | 0.996 | 0.990 | 0.717 | 1e-124 | |
| 225440628 | 312 | PREDICTED: uncharacterized protein LOC10 | 0.996 | 0.983 | 0.714 | 1e-123 | |
| 358248436 | 309 | MYB transcription factor MYB51 [Glycine | 0.983 | 0.980 | 0.707 | 1e-120 | |
| 292386082 | 304 | MYB transcription factor [Malus x domest | 0.951 | 0.963 | 0.704 | 1e-120 | |
| 149727790 | 313 | MYB transcription factor MYB33 [Medicago | 0.993 | 0.977 | 0.671 | 1e-116 | |
| 356494943 | 337 | PREDICTED: uncharacterized protein LOC10 | 0.983 | 0.899 | 0.680 | 1e-116 |
| >gi|224087718|ref|XP_002308211.1| predicted protein [Populus trichocarpa] gi|222854187|gb|EEE91734.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 484 bits (1246), Expect = e-134, Method: Compositional matrix adjust.
Identities = 233/308 (75%), Positives = 257/308 (83%), Gaps = 1/308 (0%)
Query: 1 MNRGIEILSPASYLENSNWLFQESKGTKWTPQENKQFENALAVYDKDTPDRWIKVAAMIP 60
MNRGI IL PASYL+NSNWLFQE +GTKWTP+ENKQFENALA+YDKDTPDRW+KVAA+IP
Sbjct: 1 MNRGIGILYPASYLQNSNWLFQEGEGTKWTPEENKQFENALALYDKDTPDRWLKVAALIP 60
Query: 61 GKTVGDVIKQYKELEEDVSDIEAGLIPIPGYGNDSFTLEWVDSNQGYDGLKNFYGPGGKR 120
GKTV DVIKQY+ELEEDV DIEAGLIPIPGY +DSFTLEWV SNQGYDGLK FY PGGKR
Sbjct: 61 GKTVDDVIKQYRELEEDVCDIEAGLIPIPGYNSDSFTLEWV-SNQGYDGLKQFYSPGGKR 119
Query: 121 GSSTRPSDQERKKGVPWTEEEHRQFLMGLKKFGKGDWRNISRNFVTTRTPTQVASHAQKY 180
G++TRPS+QERKKGVPWTEEEHRQFL+GL+K+GKGDWRNISRN+VTTRTPTQVASHAQKY
Sbjct: 120 GTATRPSEQERKKGVPWTEEEHRQFLLGLQKYGKGDWRNISRNYVTTRTPTQVASHAQKY 179
Query: 181 FNRQLTGGKDKRRSSIHDITTVNLDETATSSSENNKPPSPSPSAAVIQLQQQPKTVDMSN 240
F RQ TGGKDKRRSSIHDITTVNL + + S EN + SP S +Q Q QPKT
Sbjct: 180 FIRQSTGGKDKRRSSIHDITTVNLPDAKSPSPENKRLSSPDHSTTTMQSQAQPKTAGTVK 239
Query: 241 EQFNWKSQNEGTAMLFNSMNGTAFMAPFCGISSYGPKLQEQNLLGGNLNGSQFGAYSAYF 300
F+WK QNEG A ++N N PFCGISS+G KLQEQNLLGG L G QFG Y+ F
Sbjct: 240 GLFDWKQQNEGIATVYNPANDNLLTTPFCGISSHGSKLQEQNLLGGTLPGYQFGPYNFIF 299
Query: 301 QMQSMQHQ 308
QMQSMQHQ
Sbjct: 300 QMQSMQHQ 307
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255588751|ref|XP_002534707.1| DNA binding protein, putative [Ricinus communis] gi|223524722|gb|EEF27676.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|51557078|gb|AAU06309.1| MYB transcription factor [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
| >gi|12005328|gb|AAG44394.1| unknown [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
| >gi|84314023|gb|ABC55648.1| MYB transcription factor [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
| >gi|225440628|ref|XP_002278729.1| PREDICTED: uncharacterized protein LOC100263069 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|358248436|ref|NP_001240137.1| MYB transcription factor MYB51 [Glycine max] gi|255636083|gb|ACU18386.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|292386082|gb|ADE22269.1| MYB transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|149727790|gb|ABR28332.1| MYB transcription factor MYB33 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356494943|ref|XP_003516340.1| PREDICTED: uncharacterized protein LOC100813517 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 308 | ||||||
| TAIR|locus:2042872 | 298 | AT2G38090 [Arabidopsis thalian | 0.935 | 0.966 | 0.608 | 7e-93 | |
| UNIPROTKB|Q8S9H7 | 307 | DIVARICATA "Transcription fact | 0.967 | 0.970 | 0.558 | 2.4e-85 | |
| TAIR|locus:2154508 | 288 | AT5G58900 [Arabidopsis thalian | 0.821 | 0.878 | 0.547 | 7e-70 | |
| TAIR|locus:2150149 | 267 | AT5G01200 [Arabidopsis thalian | 0.727 | 0.838 | 0.577 | 5.2e-65 | |
| TAIR|locus:2166459 | 277 | AT5G05790 [Arabidopsis thalian | 0.626 | 0.696 | 0.603 | 1e-59 | |
| TAIR|locus:2074723 | 263 | AT3G11280 [Arabidopsis thalian | 0.610 | 0.714 | 0.615 | 1.9e-58 | |
| TAIR|locus:2028461 | 314 | AT1G49010 [Arabidopsis thalian | 0.311 | 0.305 | 0.66 | 8.6e-45 | |
| TAIR|locus:2159607 | 298 | AT5G08520 [Arabidopsis thalian | 0.590 | 0.610 | 0.494 | 3.9e-44 | |
| TAIR|locus:2175478 | 215 | AT5G04760 [Arabidopsis thalian | 0.652 | 0.934 | 0.422 | 1.8e-39 | |
| TAIR|locus:2171711 | 337 | AT5G23650 [Arabidopsis thalian | 0.571 | 0.522 | 0.478 | 2.2e-38 |
| TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 925 (330.7 bits), Expect = 7.0e-93, P = 7.0e-93
Identities = 190/312 (60%), Positives = 220/312 (70%)
Query: 1 MNRGIEILSPASYLENSNWLFQESKGTKWTPQENKQFENALAVYDKDTPDRWIKVAAMIP 60
MNRGIE++SPA+YLE SNWLFQE++GTKWT +ENK+FENALA YDKDTPDRW +VAAM+P
Sbjct: 1 MNRGIEVMSPATYLETSNWLFQENRGTKWTAEENKKFENALAFYDKDTPDRWSRVAAMLP 60
Query: 61 GKTVGDVIKQYKELEEDVSDIEAGLIPIPGYGNDSFTLEW--VDSNQGYDG--LKNFY-- 114
GKTVGDVIKQY+ELEEDVSDIEAGLIPIPGY +DSFTL+W D G +G + +Y
Sbjct: 61 GKTVGDVIKQYRELEEDVSDIEAGLIPIPGYASDSFTLDWGGYDGASGNNGFNMNGYYFS 120
Query: 115 GPGGKRGSSTRPSDQERKKGVPWTEEEHRQFLMGLKKFGKGDWRNISRNFVTTRTPTQVA 174
GGKRGS+ R ++ ERKKGVPWTEEEHRQFLMGLKK+GKGDWRNI+RNFVTTRTPTQVA
Sbjct: 121 AAGGKRGSAARTAEHERKKGVPWTEEEHRQFLMGLKKYGKGDWRNIARNFVTTRTPTQVA 180
Query: 175 SHAQKYFNRQLTGGKDKRRSSIHDITTVNLDETATXXXXXXXXXXXXXXAAVIQLQQQPK 234
SHAQKYF RQ+ GGKDKRRSSIHDITTVN+ ++ P
Sbjct: 181 SHAQKYFIRQVNGGKDKRRSSIHDITTVNIPDSPDAAAADNATANAPCSP--------PS 232
Query: 235 TVDMSNEQFNWKSQN--EGTAMLFNSMNGTAFMAPFCGISS--YGPKLQEQXXXXXXXXX 290
E W+ Q + TA F + N AF G+SS Y KLQEQ
Sbjct: 233 VGGNQRETSEWEGQTLYDETAAAFYNQN--AFSETLLGMSSTPYMAKLQEQSFLNA---- 286
Query: 291 SQFGAYSAYFQM 302
SQF +Y+AY QM
Sbjct: 287 SQFESYNAYLQM 298
|
|
| UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154508 AT5G58900 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2150149 AT5G01200 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166459 AT5G05790 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074723 AT3G11280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028461 AT1G49010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2159607 AT5G08520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175478 AT5G04760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171711 AT5G23650 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 308 | |||
| TIGR01557 | 57 | TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai | 6e-16 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 2e-10 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 9e-10 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 9e-10 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 1e-05 | |
| cd11660 | 50 | cd11660, SANT_TRF, Telomere repeat binding factor- | 1e-05 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 2e-05 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 2e-04 | |
| cd11661 | 46 | cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Doma | 5e-04 |
| >gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
Score = 70.5 bits (173), Expect = 6e-16
Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 4/57 (7%)
Query: 132 KKGVPWTEEEHRQFLMGLKKFGKGDW---RNISRNFVTTR-TPTQVASHAQKYFNRQ 184
K V WTE+ H +FL ++K G DW + I V T QVASH QKY +Q
Sbjct: 1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57
|
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57 |
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212559 cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Domain of MTA3 and related proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 308 | |||
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.87 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 99.86 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.8 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 99.57 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 99.54 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.49 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.46 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.43 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.22 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.2 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.18 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 99.14 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 98.98 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 98.97 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 98.9 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.85 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 98.79 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 98.78 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 98.69 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 98.62 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 98.59 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 98.43 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 98.4 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 97.75 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 97.73 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 97.69 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.62 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 97.5 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 97.28 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 97.15 | |
| PF13325 | 199 | MCRS_N: N-terminal region of micro-spherule protei | 96.84 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 96.77 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 96.75 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 96.53 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 96.52 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 96.45 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 96.37 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 96.31 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 96.14 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 95.89 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 95.44 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 94.67 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 94.54 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 94.38 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 94.02 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 93.47 | |
| PLN03162 | 526 | golden-2 like transcription factor; Provisional | 93.24 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 92.89 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 92.48 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 91.53 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 91.16 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 90.3 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 89.73 | |
| KOG4468 | 782 | consensus Polycomb-group transcriptional regulator | 89.52 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 88.98 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 88.72 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 88.51 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 85.95 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 84.9 | |
| KOG1878 | 1672 | consensus Nuclear receptor coregulator SMRT/SMRTER | 83.87 | |
| KOG2656 | 445 | consensus DNA methyltransferase 1-associated prote | 83.32 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 83.24 | |
| KOG3841 | 455 | consensus TEF-1 and related transcription factor, | 83.02 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 81.26 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 80.72 |
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
Probab=99.87 E-value=1.3e-21 Score=180.34 Aligned_cols=111 Identities=16% Similarity=0.221 Sum_probs=95.0
Q ss_pred CCCccCCCCceecCCCCCCCCHHHHHHHHHHHHHcCCCCChhHHHHHhhC-CCCCHHHHHHHHHHhhhhhhhhccCCcCC
Q 021756 10 PASYLENSNWLFQESKGTKWTPQENKQFENALAVYDKDTPDRWIKVAAMI-PGKTVGDVIKQYKELEEDVSDIEAGLIPI 88 (308)
Q Consensus 10 p~~~~~~~~~~~~~~~~~~WT~EEdk~Le~Ala~y~~~t~dRW~~IAa~v-PGRT~~qc~~rY~~L~~Dv~~IEag~v~l 88 (308)
|||+. ...+++.||+|||++|.++|++|+.. +|..||..+ +|||.+||++||.+.+.
T Consensus 16 pcc~K-------~glKRg~WT~EEDe~L~~lV~kyG~~---nW~~IAk~~g~gRT~KQCReRW~N~L~------------ 73 (249)
T PLN03212 16 PCCTK-------MGMKRGPWTVEEDEILVSFIKKEGEG---RWRSLPKRAGLLRCGKSCRLRWMNYLR------------ 73 (249)
T ss_pred CCccc-------CCCcCCCCCHHHHHHHHHHHHHhCcc---cHHHHHHhhhcCCCcchHHHHHHHhhc------------
Confidence 66665 23467889999999999999999865 499999988 59999999999998875
Q ss_pred CCCCCCCccccccccCCCCCCCccccCCCCCCCCCCCCCcccccCCCCCCHHHHHHHHHHHhhhCCCChhhhhhhhcCCC
Q 021756 89 PGYGNDSFTLEWVDSNQGYDGLKNFYGPGGKRGSSTRPSDQERKKGVPWTEEEHRQFLMGLKKFGKGDWRNISRNFVTTR 168 (308)
Q Consensus 89 P~y~~~~f~l~~~~~~~~~dg~~~~~~~ggkR~~~~~~~~~erkKg~pWTeEE~~llL~gl~kyG~G~W~~Iar~~V~tR 168 (308)
|.. +.++||+|||++||+++..||. +|..||+ +|++|
T Consensus 74 P~I-----------------------------------------~kgpWT~EED~lLlel~~~~Gn-KWs~IAk-~LpGR 110 (249)
T PLN03212 74 PSV-----------------------------------------KRGGITSDEEDLILRLHRLLGN-RWSLIAG-RIPGR 110 (249)
T ss_pred hhc-----------------------------------------ccCCCChHHHHHHHHHHHhccc-cHHHHHh-hcCCC
Confidence 321 1248999999999999999998 9999995 99999
Q ss_pred CHHHHHHHHHHHHHHHh
Q 021756 169 TPTQVASHAQKYFNRQL 185 (308)
Q Consensus 169 T~~Q~~shaqky~~r~~ 185 (308)
|+.||++||..++++..
T Consensus 111 TDnqIKNRWns~LrK~l 127 (249)
T PLN03212 111 TDNEIKNYWNTHLRKKL 127 (249)
T ss_pred CHHHHHHHHHHHHhHHH
Confidence 99999999988776653
|
|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13325 MCRS_N: N-terminal region of micro-spherule protein | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PLN03162 golden-2 like transcription factor; Provisional | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
| >KOG1878 consensus Nuclear receptor coregulator SMRT/SMRTER, contains Myb-like domains [Transcription] | Back alignment and domain information |
|---|
| >KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 308 | ||||
| 2cjj_A | 93 | Crystal Structure Of The Myb Domain Of The Rad Tran | 3e-14 | ||
| 2m2e_A | 73 | Solution Nmr Structure Of The Sant Domain Of Human | 7e-09 | ||
| 4eef_G | 74 | Crystal Structure Of The Designed Inhibitor Protein | 1e-05 | ||
| 2cu7_A | 72 | Solution Structure Of The Sant Domain Of Human Kiaa | 8e-05 |
| >pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus Length = 93 | Back alignment and structure |
|
| >pdb|2M2E|A Chain A, Solution Nmr Structure Of The Sant Domain Of Human Dnajc2, Northeast Structural Genomics Consortium Target Hr8254a Length = 73 | Back alignment and structure |
| >pdb|4EEF|G Chain G, Crystal Structure Of The Designed Inhibitor Protein F-Hb80.4 In Complex With The 1918 Influenza Virus Hemagglutinin. Length = 74 | Back alignment and structure |
| >pdb|2CU7|A Chain A, Solution Structure Of The Sant Domain Of Human Kiaa1915 Protein Length = 72 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 308 | |||
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 4e-34 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 7e-27 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 3e-05 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 3e-26 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 2e-04 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 9e-22 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 9e-07 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 1e-19 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 6e-06 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 1e-15 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 2e-14 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 8e-14 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 2e-06 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 4e-13 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 1e-11 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 5e-07 | |
| 1vf9_A | 64 | Telomeric repeat binding factor 2; MYB, helix-turn | 2e-10 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 5e-10 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 4e-09 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 6e-09 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 6e-08 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 3e-06 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 3e-07 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 3e-07 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 1e-05 | |
| 1w0u_A | 55 | Telomeric repeat binding factor 2; telomere, DNA-b | 1e-06 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 2e-06 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 7e-06 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 2e-05 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 5e-05 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 4e-05 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 4e-04 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 4e-04 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 5e-04 |
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 | Back alignment and structure |
|---|
Score = 118 bits (298), Expect = 4e-34
Identities = 36/81 (44%), Positives = 48/81 (59%)
Query: 22 QESKGTKWTPQENKQFENALAVYDKDTPDRWIKVAAMIPGKTVGDVIKQYKELEEDVSDI 81
G W+ +ENK FE ALAVYDKDTPDRW VA + G+T +V K Y+ L ED+ I
Sbjct: 4 TRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYI 63
Query: 82 EAGLIPIPGYGNDSFTLEWVD 102
E+G +P P Y ++ +
Sbjct: 64 ESGKVPFPNYRTTGGNMKTDE 84
|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 | Back alignment and structure |
|---|
| >1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Length = 70 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 308 | |||
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.93 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.92 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.92 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.91 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.91 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.88 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.87 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 99.79 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.78 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.72 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.63 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.63 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 99.61 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 99.53 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.53 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.53 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.52 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.52 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.49 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 99.48 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.47 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.46 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 99.46 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.46 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.46 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.46 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.43 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.39 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.39 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.38 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.37 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.36 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.36 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 99.32 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.31 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.31 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.99 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.31 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.29 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 99.29 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.28 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.28 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.25 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.24 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.23 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.23 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.22 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.22 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.19 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.17 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.17 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 99.16 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.13 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.12 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.11 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.11 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.1 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.07 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 99.07 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 99.05 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 99.04 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.03 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.02 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.98 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 98.95 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 98.83 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.33 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 98.76 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 98.76 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 98.69 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 98.68 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 98.65 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 98.61 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 98.59 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.55 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.52 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.48 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.41 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.33 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 97.86 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.8 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 97.7 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.64 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.56 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 97.5 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 97.47 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.42 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 96.38 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 96.21 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 96.67 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 96.63 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.32 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.16 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 95.84 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 95.81 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 93.63 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 90.16 |
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
Probab=99.93 E-value=2.1e-25 Score=180.91 Aligned_cols=103 Identities=17% Similarity=0.433 Sum_probs=90.8
Q ss_pred CCCCCHHHHHHHHHHHHHcCCCCChhHHHHHhhCCCCCHHHHHHHHHHhhhhhhhhccCCcCCCCCCCCCccccccccCC
Q 021756 26 GTKWTPQENKQFENALAVYDKDTPDRWIKVAAMIPGKTVGDVIKQYKELEEDVSDIEAGLIPIPGYGNDSFTLEWVDSNQ 105 (308)
Q Consensus 26 ~~~WT~EEdk~Le~Ala~y~~~t~dRW~~IAa~vPGRT~~qc~~rY~~L~~Dv~~IEag~v~lP~y~~~~f~l~~~~~~~ 105 (308)
++.||+|||++|..+|..|+.. +|..||..|||||..||++||.+.++ |..
T Consensus 1 K~~Wt~eED~~L~~~v~~~g~~---~W~~Ia~~~~~Rt~~qcr~Rw~~~L~------------p~i-------------- 51 (107)
T 2k9n_A 1 KVKFTEEEDLKLQQLVMRYGAK---DWIRISQLMITRNPRQCRERWNNYIN------------PAL-------------- 51 (107)
T ss_dssp CCSSCHHHHHHHHHHHHHHCSS---CHHHHHHHTTTSCHHHHHHHHHHHSS------------SCC--------------
T ss_pred CCCCCHHHHHHHHHHHHHHCCC---CHHHHhhhcCCCCHHHHHHHHHHHHc------------ccc--------------
Confidence 3679999999999999999964 49999999999999999999998764 211
Q ss_pred CCCCCccccCCCCCCCCCCCCCcccccCCCCCCHHHHHHHHHHHhhhCCCChhhhhhhhcCCCCHHHHHHHHHHHHHHHh
Q 021756 106 GYDGLKNFYGPGGKRGSSTRPSDQERKKGVPWTEEEHRQFLMGLKKFGKGDWRNISRNFVTTRTPTQVASHAQKYFNRQL 185 (308)
Q Consensus 106 ~~dg~~~~~~~ggkR~~~~~~~~~erkKg~pWTeEE~~llL~gl~kyG~G~W~~Iar~~V~tRT~~Q~~shaqky~~r~~ 185 (308)
+.++||+|||.+|+.++.+||. +|..|| .+|++||+.||++||..+.++..
T Consensus 52 ---------------------------~~~~WT~eEd~~L~~~~~~~G~-~W~~Ia-~~l~gRt~~~~k~rw~~l~r~~~ 102 (107)
T 2k9n_A 52 ---------------------------RTDPWSPEEDMLLDQKYAEYGP-KWNKIS-KFLKNRSDNNIRNRWMMIARHRA 102 (107)
T ss_dssp ---------------------------TTCCCCHHHHHHHHHHHHHTCS-CHHHHH-HHHSSSCHHHHHHHHHHHHHHHH
T ss_pred ---------------------------cccccCHHHHHHHHHHHHHhCc-CHHHHH-HHCCCCCHHHHHHHHHHHHhhHH
Confidence 1248999999999999999999 999999 49999999999999998887765
Q ss_pred c
Q 021756 186 T 186 (308)
Q Consensus 186 s 186 (308)
.
T Consensus 103 ~ 103 (107)
T 2k9n_A 103 K 103 (107)
T ss_dssp S
T ss_pred H
Confidence 4
|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 308 | ||||
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 1e-21 | |
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 4e-05 | |
| d1irza_ | 64 | a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th | 4e-18 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 4e-16 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 2e-07 | |
| d2crga1 | 57 | a.4.1.3 (A:8-64) Metastasis associated protein MTA | 4e-14 | |
| d2crga1 | 57 | a.4.1.3 (A:8-64) Metastasis associated protein MTA | 1e-05 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 5e-10 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 8e-10 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 7e-06 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 5e-09 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 9e-05 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 5e-09 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 8e-06 | |
| d1x41a1 | 47 | a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T | 3e-08 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 3e-06 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 2e-05 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 6e-05 | |
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 4e-04 |
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: DnaJ homolog subfamily C member 1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 84.1 bits (208), Expect = 1e-21
Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
Query: 27 TKWTPQENKQFENALAVYDKDTPDRWIKVAAMIPGKTVGDVIKQYKELEEDVSDIEAGLI 86
+WT ++ Q ++ + TP RW K+A + G++V DV + K+L++ V+ G++
Sbjct: 2 PEWTEEDLSQLTRSMVKFPGGTPGRWEKIAHEL-GRSVTDVTTKAKQLKDSVT-CSPGMV 59
|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 308 | |||
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.77 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.6 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.59 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.52 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.52 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.5 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.49 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.47 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.42 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.41 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.4 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.36 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.33 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.32 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.31 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 99.29 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.29 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.27 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.25 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.21 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 99.19 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.16 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.14 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.14 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.09 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.06 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.05 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.0 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.92 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 98.9 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.66 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.56 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 98.56 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 98.16 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 97.32 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 97.09 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 96.68 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 96.4 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 96.17 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 95.05 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 94.14 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 93.87 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 90.54 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 83.9 |
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: Radialis species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]
Probab=99.77 E-value=2.7e-19 Score=131.00 Aligned_cols=63 Identities=54% Similarity=0.939 Sum_probs=60.2
Q ss_pred CCCCCHHHHHHHHHHHHHcCCCCChhHHHHHhhCCCCCHHHHHHHHHHhhhhhhhhccCCcCC
Q 021756 26 GTKWTPQENKQFENALAVYDKDTPDRWIKVAAMIPGKTVGDVIKQYKELEEDVSDIEAGLIPI 88 (308)
Q Consensus 26 ~~~WT~EEdk~Le~Ala~y~~~t~dRW~~IAa~vPGRT~~qc~~rY~~L~~Dv~~IEag~v~l 88 (308)
+..||+|||++|++||+.|+.+.+++|.+||.+|||||..||++||..|++||+.||+|.||+
T Consensus 1 G~~WT~eEd~~L~~~v~~~~~~~~~~W~~Ia~~l~gRt~~qc~~r~~~L~~dik~iesg~vpf 63 (63)
T d2cjja1 1 GRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF 63 (63)
T ss_dssp CCSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred CcCCCHHHHHHHHHHHHHHCCCCchHHHHHHHHcCCCCHHHHHHHHHHHHHHhhccccCCCCC
Confidence 467999999999999999999999999999999999999999999999999999999999874
|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|