Citrus Sinensis ID: 021767

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MAFSSSTTPTVAYFSCFNTFNEISSPLFKPPKLPLFWPWEKVKMGPLSASPMGFGTWAWGNQFLWGYQESMDSQLQQTFNLAVENGINLFDTADSYGTGRLNGKSEKLLGKFISEIPGQKQVQNNIVIATKFAAYPWRLTPGQFVNACRASLARLQIEQIGIGQLHWSTANYAPPQELALWNGLVAMYEKGLVRAVGVSNYGPNQLVKIHDYLTARGVPLCSAQVQFSLLSMGENQLEIKNICDSLGIRLISYSPLGLGMLTGKYTPSKLPRGPRALLFRQILPGLKPLLRSLKEIAERRGKTIPQLL
cccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEccccccccccccccHHHHHHHHHcccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHccccccEEEEccccccccHHHHHHHHHHHHHHHHcccccEEECccccHHHHHHHHHHHHHccccEEEccccccccccccccccHHHHHHHHccEEEEEcccccccccccccccccccccccccHHcccccHHHHHHHHHHHHHHHcccccccc
**********************ISSPLFKPPKLPLFWPWEKVKMGPLSASPMGFGTWAWGNQFLWGYQESMDSQLQQTFNLAVENGINLFDTADSYGTGRLNGKSEKLLGKFISEIPGQKQVQNNIVIATKFAAYPWRLTPGQFVNACRASLARLQIEQIGIGQLHWSTANYAPPQELALWNGLVAMYEKGLVRAVGVSNYGPNQLVKIHDYLTARGVPLCSAQVQFSLLSMGENQLEIKNICDSLGIRLISYSPLGLGMLTGKYTPSKLPRGPRALLFRQILPGLKPLLRSLKEIAERRGKTIPQLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFSSSTTPTVAYFSCFNTFNEISSPLFKPPKLPLFWPWEKVKMGPLSASPMGFGTWAWGNQFLWGYQESMDSQLQQTFNLAVENGINLFDTADSYGTGRLNGKSEKLLGKFISEIPGQKQVQNNIVIATKFAAYPWRLTPGQFVNACRASLARLQIEQIGIGQLHWSTANYAPPQELALWNGLVAMYEKGLVRAVGVSNYGPNQLVKIHDYLTARGVPLCSAQVQFSLLSMGENQLEIKNICDSLGIRLISYSPLGLGMLTGKYTPSKLPRGPRALLFRQILPGLKPLLRSLKEIAERRGKTIPQLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyridoxal reductase,chloroplastic Catalyzes the reduction of pyridoxal (PL) with NADPH and oxidation of pyridoxine (PN) with NADP(+). Involved in the PLP salvage pathway.confidentQ56Y42

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LQA, chain A
Confidence level:very confident
Coverage over the Query: 39-308
View the alignment between query and template
View the model in PyMOL