Citrus Sinensis ID: 021767
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 308 | ||||||
| 225455264 | 367 | PREDICTED: uncharacterized oxidoreductas | 0.980 | 0.822 | 0.842 | 1e-146 | |
| 30696358 | 365 | aldo/keto reductase family protein [Arab | 0.990 | 0.835 | 0.785 | 1e-138 | |
| 46931336 | 365 | At5g53580 [Arabidopsis thaliana] | 0.990 | 0.835 | 0.781 | 1e-137 | |
| 297796191 | 361 | aldo/keto reductase family protein [Arab | 0.977 | 0.833 | 0.781 | 1e-137 | |
| 255549134 | 391 | aldo/keto reductase, putative [Ricinus c | 0.892 | 0.703 | 0.844 | 1e-136 | |
| 449497466 | 365 | PREDICTED: uncharacterized oxidoreductas | 0.957 | 0.808 | 0.772 | 1e-135 | |
| 449456506 | 365 | PREDICTED: uncharacterized oxidoreductas | 0.957 | 0.808 | 0.769 | 1e-135 | |
| 399920240 | 374 | aldo-keto reductase [Rosa rugosa] | 0.967 | 0.796 | 0.769 | 1e-134 | |
| 224132648 | 314 | predicted protein [Populus trichocarpa] | 0.860 | 0.843 | 0.860 | 1e-132 | |
| 302143959 | 330 | unnamed protein product [Vitis vinifera] | 0.844 | 0.787 | 0.875 | 1e-132 |
| >gi|225455264|ref|XP_002273477.1| PREDICTED: uncharacterized oxidoreductase At1g06690, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 524 bits (1349), Expect = e-146, Method: Compositional matrix adjust.
Identities = 257/305 (84%), Positives = 279/305 (91%), Gaps = 3/305 (0%)
Query: 5 SSTTPTVAYFSCFNTFNE--ISSPLFKPPKLPLFWPWEKVKMGPLSASPMGFGTWAWGNQ 62
S+ +PT AYFS F+ N+ ISS FKP KLP WPW+KVKMGPL+ SPMGFGTWAWGNQ
Sbjct: 4 STLSPT-AYFSSFSPSNDSLISSSPFKPFKLPTLWPWQKVKMGPLTVSPMGFGTWAWGNQ 62
Query: 63 FLWGYQESMDSQLQQTFNLAVENGINLFDTADSYGTGRLNGKSEKLLGKFISEIPGQKQV 122
LWGYQESMDS LQ+TFNLAVENGINLFDTADSYGTGRLNG+SEKLLGKFI E GQKQ+
Sbjct: 63 LLWGYQESMDSDLQRTFNLAVENGINLFDTADSYGTGRLNGQSEKLLGKFIREFQGQKQI 122
Query: 123 QNNIVIATKFAAYPWRLTPGQFVNACRASLARLQIEQIGIGQLHWSTANYAPPQELALWN 182
Q+NIVIATKFAAYPWRLTPGQFVNAC++SL R+Q+EQIGIGQLHWSTANYAP QELALW+
Sbjct: 123 QDNIVIATKFAAYPWRLTPGQFVNACKSSLDRMQLEQIGIGQLHWSTANYAPLQELALWD 182
Query: 183 GLVAMYEKGLVRAVGVSNYGPNQLVKIHDYLTARGVPLCSAQVQFSLLSMGENQLEIKNI 242
GLVAMYEKGLVRAVGVSNYGP QLVKIHDYL ARGVPLCSAQVQFSLLS GE+Q+EIKNI
Sbjct: 183 GLVAMYEKGLVRAVGVSNYGPKQLVKIHDYLKARGVPLCSAQVQFSLLSKGEDQIEIKNI 242
Query: 243 CDSLGIRLISYSPLGLGMLTGKYTPSKLPRGPRALLFRQILPGLKPLLRSLKEIAERRGK 302
C SLGIRLISYSPLGLGMLTGKYTPSKLPRGPRALLFRQILPGL+PLL SL+EIA++R K
Sbjct: 243 CGSLGIRLISYSPLGLGMLTGKYTPSKLPRGPRALLFRQILPGLEPLLNSLREIAQKRRK 302
Query: 303 TIPQL 307
TIPQ+
Sbjct: 303 TIPQV 307
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|30696358|ref|NP_200170.2| aldo/keto reductase family protein [Arabidopsis thaliana] gi|75218023|sp|Q56Y42.1|PLR1_ARATH RecName: Full=Pyridoxal reductase,chloroplastic; Flags: Precursor gi|62320310|dbj|BAD94642.1| aldo/keto reductase-like protein [Arabidopsis thaliana] gi|332008997|gb|AED96380.1| aldo/keto reductase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|46931336|gb|AAT06472.1| At5g53580 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297796191|ref|XP_002865980.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297311815|gb|EFH42239.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255549134|ref|XP_002515622.1| aldo/keto reductase, putative [Ricinus communis] gi|223545260|gb|EEF46767.1| aldo/keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449497466|ref|XP_004160409.1| PREDICTED: uncharacterized oxidoreductase At1g06690, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449456506|ref|XP_004145990.1| PREDICTED: uncharacterized oxidoreductase At1g06690, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|399920240|gb|AFP55587.1| aldo-keto reductase [Rosa rugosa] | Back alignment and taxonomy information |
|---|
| >gi|224132648|ref|XP_002321374.1| predicted protein [Populus trichocarpa] gi|222868370|gb|EEF05501.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|302143959|emb|CBI23064.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 308 | ||||||
| TAIR|locus:2168601 | 365 | PLR1 "AT5G53580" [Arabidopsis | 0.990 | 0.835 | 0.749 | 1.5e-120 | |
| TAIR|locus:2009120 | 377 | AT1G06690 "AT1G06690" [Arabido | 0.850 | 0.694 | 0.403 | 3e-46 | |
| TIGR_CMR|DET_0217 | 324 | DET_0217 "oxidoreductase, aldo | 0.792 | 0.753 | 0.289 | 9.2e-20 | |
| UNIPROTKB|Q0C2F5 | 344 | HNE_1371 "Dimethylsulfoxide re | 0.785 | 0.703 | 0.32 | 3.7e-18 | |
| ZFIN|ZDB-GENE-070912-690 | 369 | si:dkeyp-94h10.1 "si:dkeyp-94h | 0.798 | 0.666 | 0.283 | 5.8e-18 | |
| UNIPROTKB|Q9PWR1 | 401 | KCNAB1 "Voltage-gated potassiu | 0.798 | 0.613 | 0.280 | 8.5e-18 | |
| UNIPROTKB|I3LP21 | 334 | KCNAB2 "Uncharacterized protei | 0.795 | 0.733 | 0.282 | 8.7e-18 | |
| UNIPROTKB|F1NDV0 | 404 | KCNAB1 "Voltage-gated potassiu | 0.798 | 0.608 | 0.280 | 8.8e-18 | |
| UNIPROTKB|Q58HC3 | 353 | KCNAB2 "Potassium voltage-gate | 0.795 | 0.694 | 0.282 | 1e-17 | |
| ZFIN|ZDB-GENE-080219-36 | 440 | zgc:171453 "zgc:171453" [Danio | 0.795 | 0.556 | 0.289 | 1.2e-17 |
| TAIR|locus:2168601 PLR1 "AT5G53580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1186 (422.6 bits), Expect = 1.5e-120, P = 1.5e-120
Identities = 230/307 (74%), Positives = 255/307 (83%)
Query: 1 MAFSSSTTPTVAYFSCFNTFNEISSXXXXXXXXXXXXXXEKVKMGPLSASPMGFGTWAWG 60
MA + STT T +C N + I++ +KVKMGPLS SPMGFGTWAWG
Sbjct: 1 MALTLSTTKTFTNINCSNNTSNITTFKPLKLPLFWPW--QKVKMGPLSVSPMGFGTWAWG 58
Query: 61 NQFLWGYQESMDSQLQQTFNLAVENGINLFDTADSYGTGRLNGKSEKLLGKFISEIPGQK 120
NQ LWGYQ SMD QLQQ F LA+ENGINLFDTADSYGTGRLNG+SE+LLGKFI E G K
Sbjct: 59 NQLLWGYQTSMDDQLQQAFELALENGINLFDTADSYGTGRLNGQSERLLGKFIKESQGLK 118
Query: 121 QVQNNIVIATKFAAYPWRLTPGQFVNACRASLARLQIEQIGIGQLHWSTANYAPPQELAL 180
QN +V+ATKFAAYPWRLT GQFVNACRASL RLQI+Q+GIGQLHWSTA+YAP QEL L
Sbjct: 119 GKQNEVVVATKFAAYPWRLTSGQFVNACRASLDRLQIDQLGIGQLHWSTASYAPLQELVL 178
Query: 181 WNGLVAMYEKGLVRAVGVSNYGPNQLVKIHDYLTARGVPLCSAQVQFSLLSMGENQLEIK 240
W+GLV MYEKGLVRAVGVSNYGP QLVKIHDYL RGVPLCSAQVQFSLLSMG+ QLEIK
Sbjct: 179 WDGLVQMYEKGLVRAVGVSNYGPQQLVKIHDYLKTRGVPLCSAQVQFSLLSMGKEQLEIK 238
Query: 241 NICDSLGIRLISYSPLGLGMLTGKYTPSKLPRGPRALLFRQILPGLKPLLRSLKEIAERR 300
+ICD LGIRLISYSPLGLGMLTGKY+ SKLP GPR+LLFRQILPGL+PLL +L EIA++R
Sbjct: 239 SICDELGIRLISYSPLGLGMLTGKYSSSKLPTGPRSLLFRQILPGLEPLLLALSEIAKKR 298
Query: 301 GKTIPQL 307
GKT+PQ+
Sbjct: 299 GKTMPQV 305
|
|
| TAIR|locus:2009120 AT1G06690 "AT1G06690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0217 DET_0217 "oxidoreductase, aldo/keto reductase family" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0C2F5 HNE_1371 "Dimethylsulfoxide reductase chain B" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070912-690 si:dkeyp-94h10.1 "si:dkeyp-94h10.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9PWR1 KCNAB1 "Voltage-gated potassium channel subunit beta-1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LP21 KCNAB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NDV0 KCNAB1 "Voltage-gated potassium channel subunit beta-1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58HC3 KCNAB2 "Potassium voltage-gated channel, shaker-related subfamily, beta member 2, transcript variant 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080219-36 zgc:171453 "zgc:171453" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 308 | |||
| cd06660 | 285 | cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) | 3e-61 | |
| COG0667 | 316 | COG0667, Tas, Predicted oxidoreductases (related t | 2e-57 | |
| pfam00248 | 277 | pfam00248, Aldo_ket_red, Aldo/keto reductase famil | 1e-56 | |
| COG0656 | 280 | COG0656, ARA1, Aldo/keto reductases, related to di | 2e-34 | |
| TIGR01293 | 317 | TIGR01293, Kv_beta, voltage-dependent potassium ch | 3e-16 | |
| PRK10625 | 346 | PRK10625, tas, putative aldo-keto reductase; Provi | 3e-15 | |
| PRK09912 | 346 | PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r | 7e-15 | |
| COG4989 | 298 | COG4989, COG4989, Predicted oxidoreductase [Genera | 3e-12 | |
| PLN02587 | 314 | PLN02587, PLN02587, L-galactose dehydrogenase | 1e-10 | |
| COG1453 | 391 | COG1453, COG1453, Predicted oxidoreductases of the | 2e-10 | |
| PRK11565 | 275 | PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A | 5e-09 | |
| PRK10376 | 290 | PRK10376, PRK10376, putative oxidoreductase; Provi | 5e-04 | |
| PRK11172 | 267 | PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B | 0.002 |
| >gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
Score = 195 bits (499), Expect = 3e-61
Identities = 87/265 (32%), Positives = 125/265 (47%), Gaps = 36/265 (13%)
Query: 47 LSASPMGFGTWAWGNQFLWGYQESMDSQLQQTFNLAVENGINLFDTADSYGTGRLNGKSE 106
L S +G GTW G ++ + + A++ GIN DTAD YG +G+SE
Sbjct: 9 LKVSRLGLGTWQLGGGYV------DEEEAAAAVRAALDAGINFIDTADVYG----DGESE 58
Query: 107 KLLGKFISEIPGQKQVQNNIVIATKFAAYPW---RLTPGQFVNACRASLARLQIEQIGIG 163
+LLG+ + E +++V IATK P L+P A SL RL + I +
Sbjct: 59 ELLGEALKERGPREEV----FIATKVGPRPGDGRDLSPEHIRRAVEESLKRLGTDYIDLY 114
Query: 164 QLHWSTANYAPPQELALWNGLVAMYEKGLVRAVGVSNYGPNQLVKIHDYLTARGVPLCSA 223
LHW + P L + ++G +RA+GVSN+ QL + GVP
Sbjct: 115 LLHW--PDPDTPDIEETLRALEELVKEGKIRAIGVSNFSAEQLEEALAAA---GVPPAVN 169
Query: 224 QVQFSLLSMGENQLEIKNICDSLGIRLISYSPLGLGMLTGKYTPSKLPRGPRALLFRQIL 283
QV+++LL + + E+ C GI +I+YSPL G+LTGKY P P
Sbjct: 170 QVEYNLLDR-QAEEELLPYCREHGIGVIAYSPLAGGLLTGKYLPGAPPPEGD-------- 220
Query: 284 PGLKPLLRSLKEIAERRGKTIPQLL 308
LL +LKEIAE+ G T Q+
Sbjct: 221 -----LLEALKEIAEKHGVTPAQVA 240
|
AKRs are present in all phyla and are of importance to both health and industrial applications. Members have very distinct functions and include the prokaryotic 2,5-diketo-D-gluconic acid reductases and beta-keto ester reductases, the eukaryotic aldose reductases, aldehyde reductases, hydroxysteroid dehydrogenases, steroid 5beta-reductases, potassium channel beta-subunits and aflatoxin aldehyde reductases, among others. Length = 285 |
| >gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 308 | |||
| KOG1575 | 336 | consensus Voltage-gated shaker-like K+ channel, su | 100.0 | |
| COG0667 | 316 | Tas Predicted oxidoreductases (related to aryl-alc | 100.0 | |
| COG0656 | 280 | ARA1 Aldo/keto reductases, related to diketogulona | 100.0 | |
| PRK09912 | 346 | L-glyceraldehyde 3-phosphate reductase; Provisiona | 100.0 | |
| TIGR01293 | 317 | Kv_beta voltage-dependent potassium channel beta s | 100.0 | |
| PRK10625 | 346 | tas putative aldo-keto reductase; Provisional | 100.0 | |
| PLN02587 | 314 | L-galactose dehydrogenase | 100.0 | |
| KOG1577 | 300 | consensus Aldo/keto reductase family proteins [Gen | 100.0 | |
| PRK10376 | 290 | putative oxidoreductase; Provisional | 100.0 | |
| cd06660 | 285 | Aldo_ket_red Aldo-keto reductases (AKRs) are a sup | 100.0 | |
| PRK11172 | 267 | dkgB 2,5-diketo-D-gluconate reductase B; Provision | 100.0 | |
| COG4989 | 298 | Predicted oxidoreductase [General function predict | 100.0 | |
| PF00248 | 283 | Aldo_ket_red: Aldo/keto reductase family; InterPro | 100.0 | |
| PRK14863 | 292 | bifunctional regulator KidO; Provisional | 100.0 | |
| PRK11565 | 275 | dkgA 2,5-diketo-D-gluconate reductase A; Provision | 100.0 | |
| KOG1576 | 342 | consensus Predicted oxidoreductase [Energy product | 100.0 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 100.0 | |
| KOG3023 | 285 | consensus Glutamate-cysteine ligase regulatory sub | 98.35 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 94.09 | |
| cd03319 | 316 | L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat | 92.91 | |
| PF03102 | 241 | NeuB: NeuB family; InterPro: IPR013132 NeuB is the | 89.67 | |
| PRK08392 | 215 | hypothetical protein; Provisional | 89.18 | |
| PRK07945 | 335 | hypothetical protein; Provisional | 88.66 | |
| cd03315 | 265 | MLE_like Muconate lactonizing enzyme (MLE) like su | 84.64 | |
| PRK08609 | 570 | hypothetical protein; Provisional | 84.3 | |
| cd03316 | 357 | MR_like Mandelate racemase (MR)-like subfamily of | 83.89 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 83.63 | |
| COG0635 | 416 | HemN Coproporphyrinogen III oxidase and related Fe | 83.44 | |
| PRK09856 | 275 | fructoselysine 3-epimerase; Provisional | 83.25 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 80.68 | |
| PRK04452 | 319 | acetyl-CoA decarbonylase/synthase complex subunit | 80.48 | |
| KOG0259 | 447 | consensus Tyrosine aminotransferase [Amino acid tr | 80.16 |
| >KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.9e-55 Score=394.51 Aligned_cols=255 Identities=36% Similarity=0.581 Sum_probs=222.5
Q ss_pred CCcceeecC--CceeCcceeccCccCCCCcCCCCCCcHHHHHHHHHHHHHcCCCceeCCcCCCCCCCCCchHHHHHHHHh
Q 021767 37 WPWEKVKMG--PLSASPMGFGTWAWGNQFLWGYQESMDSQLQQTFNLAVENGINLFDTADSYGTGRLNGKSEKLLGKFIS 114 (308)
Q Consensus 37 ~~m~~~~lg--g~~vs~lglG~~~~g~~~~~~~~~~~~~~~~~~l~~A~e~Gi~~~DtA~~Yg~~~~~g~sE~~lG~~L~ 114 (308)
..|+++++| |++||++|||||.+ ..|+.. .+++++++++++|+++|+|+||||++||+ |.+|+++|++|+
T Consensus 10 ~~~~~~~lg~~gl~Vs~lglG~m~~---~~~~~~-~~~e~a~~~m~~a~e~Gin~fDtAe~Yg~----~~~E~llg~~i~ 81 (336)
T KOG1575|consen 10 LGMLRRKLGNSGLKVSPLGLGCMGW---TTFGGQ-IDKEEAFELLDHAYEAGINFFDTAEVYGN----GQSEELLGEFIK 81 (336)
T ss_pred hcceeeeccCCCceecceeecceee---eccccC-CCHHHHHHHHHHHHHcCCCEEehhhhcCC----cccHHHHHHHHH
Confidence 458999999 89999999999843 345555 78899999999999999999999999998 999999999999
Q ss_pred hCCCCCCCCCCEEEEeccCCCC-----CCCChHHHHHHHHHHHHhhCCCcccEEEecCCCCCCCChhHHHHHHHHHHHHH
Q 021767 115 EIPGQKQVQNNIVIATKFAAYP-----WRLTPGQFVNACRASLARLQIEQIGIGQLHWSTANYAPPQELALWNGLVAMYE 189 (308)
Q Consensus 115 ~~~~~~~~R~~v~i~tK~~~~~-----~~~~~~~i~~~~e~sL~~L~~d~iDl~~lH~~~~~~~~~~~~~~~~~l~~l~~ 189 (308)
+++ ..|++|+|+||++... .+.+..++...++.||++|+++||||||+||+|.. .|++ +++++|.++++
T Consensus 82 ~~~---~~R~~vviaTK~~~~~~~~~~~G~~~~~i~~~~~~s~~rl~~~~IDl~q~Hr~D~~-~pie--e~m~aL~~lve 155 (336)
T KOG1575|consen 82 SRG---WRRDKVVIATKFGFDYGGETPRGLSRKHIIEGVRDSLRRLQTDYIDLLQVHRWDPM-VPIE--ETMRALTDLVE 155 (336)
T ss_pred hcC---CcCCcEEEEEEEeccCCCcCCCCCcHHHHHHHHHHHHHhcCCCeeEEEEEcccCCC-CCHH--HHHHHHHHHHh
Confidence 965 5899999999998643 55688999999999999999999999999998754 6765 49999999999
Q ss_pred cCCccEEEeecCCHHHHHHHHHHHHHcCCCceeeeeccCcccCCcchhhHHHHHHHhCCcEEEcccccccccCCCCCCC-
Q 021767 190 KGLVRAVGVSNYGPNQLVKIHDYLTARGVPLCSAQVQFSLLSMGENQLEIKNICDSLGIRLISYSPLGLGMLTGKYTPS- 268 (308)
Q Consensus 190 ~G~ir~iGvSn~~~~~l~~~~~~~~~~~~~~~~~Q~~~~~~~~~~~~~~l~~~~~~~gi~v~a~spl~~G~L~~~~~~~- 268 (308)
+||||+||+|+++++++.++...+. +|+.++|++||+++|+.++.+++++|++.||++++||||++|+|+++|...
T Consensus 156 ~Gki~yiGlSe~sa~~I~~a~~~~~---~p~~s~Q~eysl~~Rd~ee~~i~~~c~~~Gi~li~ysPL~~G~Ltgk~~~~e 232 (336)
T KOG1575|consen 156 QGKIRYWGLSEWSAEEIREAHAVAP---IPIVAVQVEYSLLSRDKEERGIIPLCRELGIGLIAWSPLGRGLLTGKYKLGE 232 (336)
T ss_pred cCceEEEEeccCCHHHHHHHHHhcC---CCceEeeeechhhhcchhhhhHHHHHHHcCcceEEecccccceeccCccccc
Confidence 9999999999999999999988743 669999999999999988878999999999999999999999999998654
Q ss_pred CCCCCchhhhhhccc------cChHHHHHHHHHHHHHhCCCcccCC
Q 021767 269 KLPRGPRALLFRQIL------PGLKPLLRSLKEIAERRGKTIPQLL 308 (308)
Q Consensus 269 ~~~~~~~~~~~~~~~------~~~~~~~~~l~~ia~~~g~s~aqva 308 (308)
+.+.+.....|.... +.+..+++++.++|+|+|+|++|+|
T Consensus 233 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iA~k~g~T~~qlA 278 (336)
T KOG1575|consen 233 DSRNGDKRFQFLGLSPQTEEGDKQKPILEALSKIAEKHGCTVPQLA 278 (336)
T ss_pred ccccccccccccccccccchhhhHHHHHHHHHHHHHHcCCCHHHHH
Confidence 445554443333322 4477889999999999999999986
|
|
| >COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >PRK10625 tas putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02587 L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10376 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >COG4989 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] | Back alignment and domain information |
|---|
| >PRK14863 bifunctional regulator KidO; Provisional | Back alignment and domain information |
|---|
| >PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides | Back alignment and domain information |
|---|
| >PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) | Back alignment and domain information |
|---|
| >PRK08392 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07945 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily | Back alignment and domain information |
|---|
| >PRK08609 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09856 fructoselysine 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04452 acetyl-CoA decarbonylase/synthase complex subunit delta; Provisional | Back alignment and domain information |
|---|
| >KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 308 | ||||
| 3uyi_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 5e-20 | ||
| 3v0t_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 3e-19 | ||
| 3v0u_A | 338 | Crystal Structure Of Perakine Reductase, Founder Me | 3e-19 | ||
| 3v0s_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 2e-18 | ||
| 3n2t_A | 348 | Structure Of The Glycerol Dehydrogenase Akr11b4 Fro | 2e-16 | ||
| 1zsx_A | 347 | Crystal Structure Of Human Potassium Channel Kv Bet | 3e-16 | ||
| 1pz1_A | 333 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 7e-16 | ||
| 2a79_A | 333 | Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu | 8e-16 | ||
| 1exb_A | 332 | Structure Of The Cytoplasmic Beta Subunit-T1 Assemb | 9e-16 | ||
| 1qrq_A | 325 | Structure Of A Voltage-Dependent K+ Channel Beta Su | 9e-16 | ||
| 3eau_A | 327 | Voltage-Dependent K+ Channel Beta Subunit In Comple | 9e-16 | ||
| 3eb3_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (W121a) I | 1e-15 | ||
| 3lut_A | 367 | A Structural Model For The Full-Length Shaker Potas | 1e-15 | ||
| 3eb4_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (I211r) I | 2e-15 | ||
| 4aub_A | 366 | The Complex Structure Of The Bacterial Aldo-Keto Re | 6e-13 | ||
| 3n6q_A | 346 | Crystal Structure Of Yghz From E. Coli Length = 346 | 6e-13 | ||
| 1lqa_A | 346 | Tas Protein From Escherichia Coli In Complex With N | 1e-12 | ||
| 2wzm_A | 283 | Crystal Structure Of A Mycobacterium Aldo-Keto Redu | 1e-12 | ||
| 1pyf_A | 312 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 2e-12 | ||
| 1qwk_A | 317 | Structural Genomics Of Caenorhabditis Elegans: Hypo | 2e-11 | ||
| 1ynp_A | 317 | Aldo-keto Reductase Akr11c1 From Bacillus Haloduran | 6e-10 | ||
| 1cwn_A | 324 | Crystal Structure Of Porcine Aldehyde Reductase Hol | 1e-09 | ||
| 1ae4_A | 325 | Aldehyde Reductase Complexed With Cofactor And Inhi | 2e-09 | ||
| 3cv7_A | 325 | Crystal Structure Of Porcine Aldehyde Reductase Ter | 2e-09 | ||
| 3h7u_A | 335 | Crystal Structure Of The Plant Stress-Response Enzy | 5e-09 | ||
| 3erp_A | 353 | Structure Of Idp01002, A Putative Oxidoreductase Fr | 6e-09 | ||
| 1hqt_A | 326 | The Crystal Structure Of An Aldehyde Reductase Y50f | 8e-09 | ||
| 2alr_A | 324 | Aldehyde Reductase Length = 324 | 1e-08 | ||
| 4gac_A | 324 | High Resolution Structure Of Mouse Aldehyde Reducta | 3e-08 | ||
| 2bgq_A | 344 | Apo Aldose Reductase From Barley Length = 344 | 1e-07 | ||
| 1zgd_A | 312 | Chalcone Reductase Complexed With Nadp+ At 1.7 Angs | 1e-07 | ||
| 3krb_A | 334 | Structure Of Aldose Reductase From Giardia Lamblia | 2e-07 | ||
| 3h7r_A | 331 | Crystal Structure Of The Plant Stress-Response Enzy | 2e-07 | ||
| 3qkz_A | 316 | Crystal Structure Of Mutant His269arg Akr1b14 Lengt | 1e-06 | ||
| 3o3r_A | 316 | Crystal Structure Of Akr1b14 In Complex With Nadp L | 1e-06 | ||
| 2bp1_B | 360 | Structure Of The Aflatoxin Aldehyde Reductase In Co | 1e-06 | ||
| 1q5m_A | 322 | Binary Complex Of Rabbit 20alpha-Hydroxysteroid Deh | 2e-06 | ||
| 1q13_A | 323 | Crystal Structure Of Rabbit 20alpha Hyroxysteroid D | 2e-06 | ||
| 3cv6_A | 323 | The Crystal Structure Of Mouse 17-Alpha Hydroxyster | 2e-06 | ||
| 1mzr_A | 296 | Structure Of Dkga From E.Coli At 2.13 A Resolution | 2e-06 | ||
| 4f40_A | 288 | X-Ray Crystal Structure Of Apo Prostaglandin F Synt | 2e-06 | ||
| 1frb_A | 315 | Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 | 2e-06 | ||
| 2c91_A | 338 | Mouse Succinic Semialdehyde Reductase, Akr7a5 Lengt | 3e-06 | ||
| 1hw6_A | 278 | Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red | 4e-06 | ||
| 1zua_X | 317 | Crystal Structure Of Akr1b10 Complexed With Nadp+ A | 4e-06 | ||
| 1a80_A | 277 | Native 2,5-Diketo-D-Gluconic Acid Reductase A From | 4e-06 | ||
| 1m9h_A | 278 | Corynebacterium 2,5-dkgr A And Phe 22 Replaced With | 4e-06 | ||
| 4fzi_A | 290 | Crystal Structure Of Prostaglandin F Synthase From | 4e-06 | ||
| 3fjn_A | 323 | The Crystal Structure Of 17-Alpha Hydroxysteroid De | 4e-06 | ||
| 2he5_A | 323 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 4e-06 | ||
| 2ipf_A | 318 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 5e-06 | ||
| 2ipg_A | 319 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 6e-06 | ||
| 3b3d_A | 314 | B.Subtilis Ytbe Length = 314 | 7e-06 | ||
| 3gug_A | 323 | Crystal Structure Of Akr1c1 L308v Mutant In Complex | 1e-05 | ||
| 1mrq_A | 323 | Crystal Structure Of Human 20alpha-hsd In Ternary C | 1e-05 | ||
| 3c3u_A | 323 | Crystal Structure Of Akr1c1 In Complex With Nadp An | 1e-05 | ||
| 1xjb_A | 325 | Crystal Structure Of Human Type 3 3alpha-Hydroxyste | 2e-05 | ||
| 1ihi_A | 323 | Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy | 2e-05 | ||
| 1j96_A | 323 | Human 3alpha-Hsd Type 3 In Ternary Complex With Nad | 2e-05 | ||
| 4exa_A | 292 | Crystal Structure Of The Pa4992, The Putative Aldo- | 3e-05 | ||
| 1vbj_A | 281 | The Crystal Structure Of Prostaglandin F Synthase F | 3e-05 | ||
| 3ln3_A | 324 | Crystal Structure Of Putative Reductase (Np_038806. | 3e-05 | ||
| 3f7j_A | 276 | B.Subtilis Yvgn Length = 276 | 4e-05 | ||
| 3d3f_A | 275 | Crystal Structure Of Yvgn And Cofactor Nadph From B | 4e-05 | ||
| 1vp5_A | 298 | Crystal Structure Of 2,5-diketo-d-gluconic Acid Red | 4e-05 | ||
| 2ipj_A | 321 | Crystal Structure Of H3alpha-Hydroxysteroid Dehydro | 7e-05 | ||
| 3o0k_A | 283 | Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL | 8e-05 | ||
| 1ah0_A | 316 | Pig Aldose Reductase Complexed With Sorbinil Length | 1e-04 | ||
| 1c9w_A | 315 | Cho Reductase With Nadp+ Length = 315 | 1e-04 | ||
| 1dla_A | 314 | Novel Nadph-Binding Domain Revealed By The Crystal | 1e-04 | ||
| 1eko_A | 315 | Pig Aldose Reductase Complexed With Idd384 Inhibito | 1e-04 | ||
| 1lwi_A | 322 | 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO | 1e-04 | ||
| 1afs_A | 323 | Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr | 1e-04 | ||
| 1ral_A | 308 | Three-Dimensional Structure Of Rat Liver 3alpha- Hy | 1e-04 | ||
| 2ipw_A | 315 | Crystal Structure Of C298a W219y Aldose Reductase C | 2e-04 | ||
| 3rx2_A | 336 | Crystal Structure Of Human Aldose Reductase Complex | 3e-04 | ||
| 1z3n_A | 319 | Human Aldose Reductase In Complex With Nadp+ And Th | 4e-04 | ||
| 2agt_A | 319 | Aldose Reductase Mutant Leu 300 Pro Complexed With | 4e-04 | ||
| 1pwl_A | 316 | Crystal Structure Of Human Aldose Reductase Complex | 4e-04 | ||
| 1ry0_A | 323 | Structure Of Prostaglandin F Synthase With Prostagl | 4e-04 | ||
| 2pdf_A | 316 | Human Aldose Reductase Mutant L300p Complexed With | 4e-04 | ||
| 2pdb_A | 316 | Human Aldose Reductase Mutant F121p Complexed With | 4e-04 | ||
| 2r24_A | 316 | Human Aldose Reductase Structure Length = 316 | 4e-04 | ||
| 2pdm_A | 316 | Human Aldose Reductase Mutant S302r Complexed With | 4e-04 | ||
| 2pdk_A | 316 | Human Aldose Reductase Mutant L301m Complexed With | 4e-04 | ||
| 2pdi_A | 316 | Human Aldose Reductase Mutant L300a Complexed With | 4e-04 | ||
| 2is7_A | 315 | Crystal Structure Of Aldose Reductase Complexed Wit | 4e-04 | ||
| 1el3_A | 316 | Human Aldose Reductase Complexed With Idd384 Inhibi | 4e-04 | ||
| 1xgd_A | 315 | Apo R268a Human Aldose Reductase Length = 315 | 4e-04 | ||
| 3r43_A | 331 | Akr1c3 Complexed With Mefenamic Acid Length = 331 | 4e-04 | ||
| 1ef3_A | 315 | Fidarestat Bound To Human Aldose Reductase Length = | 4e-04 | ||
| 1s1p_A | 331 | Crystal Structures Of Prostaglandin D2 11-Ketoreduc | 4e-04 | ||
| 2pdq_A | 316 | Human Aldose Reductase Mutant C303d Complexed With | 4e-04 | ||
| 1abn_A | 315 | The Crystal Structure Of The Aldose Reductase Nadph | 4e-04 | ||
| 3uwe_A | 331 | Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length | 4e-04 | ||
| 2pdx_A | 316 | Human Aldose Reductase Double Mutant S302r-C303d Co | 4e-04 | ||
| 3q67_A | 316 | Human Aldose Reductase C298s Mutant In Complex With | 5e-04 | ||
| 2pd5_A | 316 | Human Aldose Reductase Mutant V47i Complexed With Z | 5e-04 | ||
| 3lqg_A | 316 | Human Aldose Reductase Mutant T113a Complexed With | 6e-04 | ||
| 3onb_A | 315 | Bond Breakage And Relocation Of A Covalently Bound | 7e-04 | ||
| 2fvl_A | 324 | Crystal Structure Of Human 3-alpha Hydroxysteroid/d | 8e-04 |
| >pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
|
| >pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 | Back alignment and structure |
| >pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 | Back alignment and structure |
| >pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 | Back alignment and structure |
| >pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 | Back alignment and structure |
| >pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 | Back alignment and structure |
| >pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 | Back alignment and structure |
| >pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 | Back alignment and structure |
| >pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 | Back alignment and structure |
| >pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 | Back alignment and structure |
| >pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 | Back alignment and structure |
| >pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 | Back alignment and structure |
| >pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 | Back alignment and structure |
| >pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 | Back alignment and structure |
| >pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 | Back alignment and structure |
| >pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 | Back alignment and structure |
| >pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 | Back alignment and structure |
| >pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 | Back alignment and structure |
| >pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 | Back alignment and structure |
| >pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 | Back alignment and structure |
| >pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 | Back alignment and structure |
| >pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 | Back alignment and structure |
| >pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 | Back alignment and structure |
| >pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 | Back alignment and structure |
| >pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 | Back alignment and structure |
| >pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 | Back alignment and structure |
| >pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 | Back alignment and structure |
| >pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 | Back alignment and structure |
| >pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 | Back alignment and structure |
| >pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 | Back alignment and structure |
| >pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha-Hydroxysteroid Dehydrogenase With Nadph Length = 322 | Back alignment and structure |
| >pdb|1Q13|A Chain A, Crystal Structure Of Rabbit 20alpha Hyroxysteroid Dehydrogenase In Ternary Complex With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 | Back alignment and structure |
| >pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 | Back alignment and structure |
| >pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 | Back alignment and structure |
| >pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 | Back alignment and structure |
| >pdb|2C91|A Chain A, Mouse Succinic Semialdehyde Reductase, Akr7a5 Length = 338 | Back alignment and structure |
| >pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 | Back alignment and structure |
| >pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 | Back alignment and structure |
| >pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 | Back alignment and structure |
| >pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 | Back alignment and structure |
| >pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 | Back alignment and structure |
| >pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 | Back alignment and structure |
| >pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 | Back alignment and structure |
| >pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 | Back alignment and structure |
| >pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 | Back alignment and structure |
| >pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 | Back alignment and structure |
| >pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 | Back alignment and structure |
| >pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 | Back alignment and structure |
| >pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 | Back alignment and structure |
| >pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 | Back alignment and structure |
| >pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 | Back alignment and structure |
| >pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|4EXA|A Chain A, Crystal Structure Of The Pa4992, The Putative Aldo-keto Reductase From Pseudomona Aeruginosa Length = 292 | Back alignment and structure |
| >pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 | Back alignment and structure |
| >pdb|3LN3|A Chain A, Crystal Structure Of Putative Reductase (Np_038806.2) From Mus Musculus At 1.18 A Resolution Length = 324 | Back alignment and structure |
| >pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 | Back alignment and structure |
| >pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 | Back alignment and structure |
| >pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 | Back alignment and structure |
| >pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 | Back alignment and structure |
| >pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 | Back alignment and structure |
| >pdb|1AH0|A Chain A, Pig Aldose Reductase Complexed With Sorbinil Length = 316 | Back alignment and structure |
| >pdb|1C9W|A Chain A, Cho Reductase With Nadp+ Length = 315 | Back alignment and structure |
| >pdb|1DLA|A Chain A, Novel Nadph-Binding Domain Revealed By The Crystal Structure Of Aldose Reductase Length = 314 | Back alignment and structure |
| >pdb|1EKO|A Chain A, Pig Aldose Reductase Complexed With Idd384 Inhibitor Length = 315 | Back alignment and structure |
| >pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 | Back alignment and structure |
| >pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 | Back alignment and structure |
| >pdb|2IPW|A Chain A, Crystal Structure Of C298a W219y Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 | Back alignment and structure |
| >pdb|3RX2|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Sulindac Sulfone Length = 336 | Back alignment and structure |
| >pdb|1Z3N|A Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Lidorestat At 1.04 Angstrom Length = 319 | Back alignment and structure |
| >pdb|2AGT|A Chain A, Aldose Reductase Mutant Leu 300 Pro Complexed With Fidarestat Length = 319 | Back alignment and structure |
| >pdb|1PWL|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Nadp And Minalrestat Length = 316 | Back alignment and structure |
| >pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 | Back alignment and structure |
| >pdb|2PDF|A Chain A, Human Aldose Reductase Mutant L300p Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2PDB|A Chain A, Human Aldose Reductase Mutant F121p Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2R24|A Chain A, Human Aldose Reductase Structure Length = 316 | Back alignment and structure |
| >pdb|2PDM|A Chain A, Human Aldose Reductase Mutant S302r Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2PDK|A Chain A, Human Aldose Reductase Mutant L301m Complexed With Sorbinil. Length = 316 | Back alignment and structure |
| >pdb|2PDI|A Chain A, Human Aldose Reductase Mutant L300a Complexed With Zopolrestat At 1.55 A. Length = 316 | Back alignment and structure |
| >pdb|2IS7|A Chain A, Crystal Structure Of Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 | Back alignment and structure |
| >pdb|1EL3|A Chain A, Human Aldose Reductase Complexed With Idd384 Inhibitor Length = 316 | Back alignment and structure |
| >pdb|1XGD|A Chain A, Apo R268a Human Aldose Reductase Length = 315 | Back alignment and structure |
| >pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 | Back alignment and structure |
| >pdb|1EF3|A Chain A, Fidarestat Bound To Human Aldose Reductase Length = 315 | Back alignment and structure |
| >pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 | Back alignment and structure |
| >pdb|2PDQ|A Chain A, Human Aldose Reductase Mutant C303d Complexed With Uracil- Type Inhibitor. Length = 316 | Back alignment and structure |
| >pdb|1ABN|A Chain A, The Crystal Structure Of The Aldose Reductase Nadph Binary Complex Length = 315 | Back alignment and structure |
| >pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 | Back alignment and structure |
| >pdb|2PDX|A Chain A, Human Aldose Reductase Double Mutant S302r-C303d Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|3Q67|A Chain A, Human Aldose Reductase C298s Mutant In Complex With Nadp+ In Space Group P212121 Length = 316 | Back alignment and structure |
| >pdb|2PD5|A Chain A, Human Aldose Reductase Mutant V47i Complexed With Zopolrestat Length = 316 | Back alignment and structure |
| >pdb|3LQG|A Chain A, Human Aldose Reductase Mutant T113a Complexed With Idd388 Length = 316 | Back alignment and structure |
| >pdb|3ONB|A Chain A, Bond Breakage And Relocation Of A Covalently Bound Bromine Of Idd594 In A Complex With Har T113a Mutant After Extensive Radiation Dose Length = 315 | Back alignment and structure |
| >pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 308 | |||
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 2e-49 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 5e-48 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 1e-46 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 4e-40 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 5e-40 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 2e-39 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 2e-38 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 2e-38 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 4e-38 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 1e-37 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 6e-35 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 4e-34 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 3e-31 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 1e-21 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 5e-20 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 5e-20 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 6e-20 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 4e-19 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 2e-18 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 2e-18 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 2e-18 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 2e-18 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 4e-18 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 4e-18 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 7e-18 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 1e-17 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 1e-17 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 2e-17 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 3e-17 | |
| 2ao0_A | 324 | Aldehyde dehydrogenase; TIM barrel, aldo-keto redu | 3e-17 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 4e-17 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 6e-17 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 6e-17 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 7e-17 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 8e-17 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 9e-17 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 1e-16 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 2e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 |
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 | Back alignment and structure |
|---|
Score = 165 bits (421), Expect = 2e-49
Identities = 79/289 (27%), Positives = 120/289 (41%), Gaps = 49/289 (16%)
Query: 40 EKVKMGP--LSASPMGFGTWAWGNQFLWGYQESMDSQLQQTFNLAVENGINLFDTADSYG 97
+K K+G L P+G GT A G L+ + ++ A+ NG+ + DTA YG
Sbjct: 2 KKAKLGKSDLQVFPIGLGTNAVGGHNLYPNLN--EETGKELVREAIRNGVTMLDTAYIYG 59
Query: 98 TGRLNGKSEKLLGKFISEIPGQKQVQNNIVIATKFAAYPWRLTPGQFV---------NAC 148
GR SE+L+G+ + E + +VIATK A R FV +
Sbjct: 60 IGR----SEELIGEVLREFNRED-----VVIATKAA---HRKQGNDFVFDNSPDFLKKSV 107
Query: 149 RASLARLQIEQIGIGQLHWSTANYAPPQELALWNGLVAMYEKGLVRAVGVSNYGPNQLVK 208
SL RL + I + +H+ + P++ A N L M + G +R++GVSN+ QL +
Sbjct: 108 DESLKRLNTDYIDLFYIHF--PDEHTPKDEA-VNALNEMKKAGKIRSIGVSNFSLEQLKE 164
Query: 209 IHDYLTARGV-PLCSAQVQFSLLSMGENQLEIKNICDSLGIRLISYSPLGLGMLTGKYTP 267
A + Q +++LL+ + I I Y PL G+L GKYT
Sbjct: 165 ------ANKDGLVDVLQGEYNLLNREAEK-TFFPYTKEHNISFIPYFPLVSGLLAGKYTE 217
Query: 268 -SKLPRGPRALLFRQILPGLKP--------LLRSLKEIAERRGKTIPQL 307
+ P G R K + L IAE+ IP +
Sbjct: 218 DTTFPEGD----LRNEQEHFKGERFKENIRKVNKLAPIAEKHNVDIPHI 262
|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 308 | |||
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 100.0 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 100.0 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 100.0 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 100.0 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 100.0 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 100.0 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 100.0 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 100.0 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 100.0 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 100.0 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 100.0 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 100.0 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 100.0 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 100.0 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 100.0 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 100.0 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 100.0 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 100.0 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 100.0 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 100.0 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 100.0 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 100.0 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 100.0 | |
| 4exb_A | 292 | Putative uncharacterized protein; aldo-keto reduct | 100.0 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 100.0 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 100.0 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 100.0 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 100.0 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 100.0 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 100.0 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 100.0 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 100.0 | |
| 3b3d_A | 314 | YTBE protein, putative morphine dehydrogenase; ald | 100.0 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 100.0 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 100.0 | |
| 4gac_A | 324 | Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe | 100.0 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 97.66 | |
| 3i4k_A | 383 | Muconate lactonizing enzyme; structural genomics, | 89.42 | |
| 3gd6_A | 391 | Muconate cycloisomerase; structural genomics, NYSG | 87.99 | |
| 2ovl_A | 371 | Putative racemase; structural genomics, PSI-2, pro | 87.4 | |
| 2rdx_A | 379 | Mandelate racemase/muconate lactonizing enzyme, P; | 86.84 | |
| 2zad_A | 345 | Muconate cycloisomerase; muconate lactonizing enzy | 86.81 | |
| 1tkk_A | 366 | Similar to chloromuconate cycloisomerase; epimeras | 86.2 | |
| 1nu5_A | 370 | Chloromuconate cycloisomerase; enzyme, dehalogenat | 86.07 | |
| 1r0m_A | 375 | N-acylamino acid racemase; isomerase; 1.30A {Deino | 85.96 | |
| 2pgw_A | 384 | Muconate cycloisomerase; enolase superfamily, octa | 85.81 | |
| 3mwc_A | 400 | Mandelate racemase/muconate lactonizing protein; e | 85.8 | |
| 2o56_A | 407 | Putative mandelate racemase; dehydratase, structur | 84.7 | |
| 2p8b_A | 369 | Mandelate racemase/muconate lactonizing enzyme fam | 84.61 | |
| 3i6e_A | 385 | Muconate cycloisomerase I; structural genomics, NY | 84.47 | |
| 3q45_A | 368 | Mandelate racemase/muconate lactonizing enzyme FA | 84.34 | |
| 2nql_A | 388 | AGR_PAT_674P, isomerase/lactonizing enzyme; enolas | 84.33 | |
| 2qgy_A | 391 | Enolase from the environmental genome shotgun sequ | 84.27 | |
| 1mdl_A | 359 | Mandelate racemase; isomerase, mandelate pathway, | 84.23 | |
| 3dg3_A | 367 | Muconate cycloisomerase; muconate lactonizing enzy | 83.7 | |
| 3p6l_A | 262 | Sugar phosphate isomerase/epimerase; TIM barrel, s | 83.21 | |
| 2og9_A | 393 | Mandelate racemase/muconate lactonizing enzyme; NY | 82.97 | |
| 1sjd_A | 368 | N-acylamino acid racemase; lyase, isomerase; HET: | 82.89 | |
| 3jva_A | 354 | Dipeptide epimerase; enolase superfamily, isomeras | 82.8 | |
| 2qde_A | 397 | Mandelate racemase/muconate lactonizing enzyme FA | 82.75 | |
| 3ik4_A | 365 | Mandelate racemase/muconate lactonizing protein; s | 82.27 | |
| 2poz_A | 392 | Putative dehydratase; octamer, structural genomics | 81.84 | |
| 2hzg_A | 401 | Mandelate racemase/muconate lactonizing enzyme/EN | 80.86 | |
| 3rr1_A | 405 | GALD, putative D-galactonate dehydratase; enolase, | 80.6 | |
| 2pp0_A | 398 | L-talarate/galactarate dehydratase; enolase superf | 80.59 | |
| 3qld_A | 388 | Mandelate racemase/muconate lactonizing protein; s | 80.57 |
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.6e-56 Score=414.98 Aligned_cols=253 Identities=27% Similarity=0.463 Sum_probs=211.6
Q ss_pred CCcceeecC--CceeCcceeccC-ccCCCCcCCCCCCcHHHHHHHHHHHHHcCCCceeCCcCCCCCCCCCchHHHHHHHH
Q 021767 37 WPWEKVKMG--PLSASPMGFGTW-AWGNQFLWGYQESMDSQLQQTFNLAVENGINLFDTADSYGTGRLNGKSEKLLGKFI 113 (308)
Q Consensus 37 ~~m~~~~lg--g~~vs~lglG~~-~~g~~~~~~~~~~~~~~~~~~l~~A~e~Gi~~~DtA~~Yg~~~~~g~sE~~lG~~L 113 (308)
..| |++|| |++||+|||||| .+|+ ..+++++.++|+.|++.|||+||||+.||+ |.||+.||++|
T Consensus 36 ~~m-yr~lG~tg~~vs~iglGt~~~~g~-------~~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~----G~sE~~lG~al 103 (367)
T 3lut_A 36 LQF-YRNLGKSGLRVSCLGLGTWVTFGG-------QITDEMAEHLMTLAYDNGINLFDTAEVYAA----GKAEVVLGNII 103 (367)
T ss_dssp CCS-EEESTTSSCEEESEEEECTTCCCC-------CSCHHHHHHHHHHHHHTTCCEEEEETTGGG----GHHHHHHHHHH
T ss_pred hhc-eeecCCCCCcccceeECCccccCC-------CCCHHHHHHHHHHHHHcCCCEEECccccCC----CchHHHHHHHH
Confidence 359 99999 999999999998 4442 256788999999999999999999999998 99999999999
Q ss_pred hhCCCCCCCCCCEEEEeccCCCC-----CCCChHHHHHHHHHHHHhhCCCcccEEEecCCCCCCCChhHHHHHHHHHHHH
Q 021767 114 SEIPGQKQVQNNIVIATKFAAYP-----WRLTPGQFVNACRASLARLQIEQIGIGQLHWSTANYAPPQELALWNGLVAMY 188 (308)
Q Consensus 114 ~~~~~~~~~R~~v~i~tK~~~~~-----~~~~~~~i~~~~e~sL~~L~~d~iDl~~lH~~~~~~~~~~~~~~~~~l~~l~ 188 (308)
++.. ++|+++||+||++... .+.+++.+++++++||++||+||||||++|||+.. .+. +++|++|++|+
T Consensus 104 ~~~~---~~R~~v~I~TK~~~~~~~~~~~~~s~~~i~~~~e~SL~rLg~dyiDl~~lH~pd~~-~~~--~e~~~al~~l~ 177 (367)
T 3lut_A 104 KKKG---WRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPN-TPM--EETVRAMTHVI 177 (367)
T ss_dssp HHHT---CCGGGCEEEEEESBCCSSGGGBSSCHHHHHHHHHHHHHHHTCSCEEEEEESSCCTT-SCH--HHHHHHHHHHH
T ss_pred HhCC---CCCceEEEEeccccCCCCccCCCCCHHHHHHHHHHHHHHhCCCccceEEecCCCCC-CCH--HHHHHHHHHHH
Confidence 8742 5799999999995421 24579999999999999999999999999999754 343 45999999999
Q ss_pred HcCCccEEEeecCCHHHHHHHHHHHHHcC-CCceeeeeccCcccCCcchhhHHHHHHHhCCcEEEcccccccccCCCCCC
Q 021767 189 EKGLVRAVGVSNYGPNQLVKIHDYLTARG-VPLCSAQVQFSLLSMGENQLEIKNICDSLGIRLISYSPLGLGMLTGKYTP 267 (308)
Q Consensus 189 ~~G~ir~iGvSn~~~~~l~~~~~~~~~~~-~~~~~~Q~~~~~~~~~~~~~~l~~~~~~~gi~v~a~spl~~G~L~~~~~~ 267 (308)
++||||+||||||+.+++.++...++..+ ++|+++|++||++++...+.+++++|+++||++++|+||++|+|+++|..
T Consensus 178 ~~Gkir~iGvSn~~~~~l~~~~~~~~~~~~~~~~~~Q~~~~~~~~~~~e~~l~~~~~~~gi~v~a~spL~~G~Ltgk~~~ 257 (367)
T 3lut_A 178 NQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDS 257 (367)
T ss_dssp HTTSEEEEEEESCCHHHHHHHHHHHHHHTCCCCCEEEEECBTTBCHHHHTHHHHHHHHHCCEEEEECTTGGGGGGTTTTT
T ss_pred HcCCeeEEEecCCCHHHHHHHHHHHHHcCCCCceeeeccccceecchhHhHHHHHHHHcCCeEEEecccccccccCCcCC
Confidence 99999999999999999999988876655 58999999999998876444899999999999999999999999999976
Q ss_pred CCCCCCchhhh--h--------hccccChHHHHHHHHHHHHHhCCCcccCC
Q 021767 268 SKLPRGPRALL--F--------RQILPGLKPLLRSLKEIAERRGKTIPQLL 308 (308)
Q Consensus 268 ~~~~~~~~~~~--~--------~~~~~~~~~~~~~l~~ia~~~g~s~aqva 308 (308)
..++ ..+... + ..........++.|+++|++||+|++|||
T Consensus 258 ~~~~-~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~iA~~~g~t~aqva 307 (367)
T 3lut_A 258 GIPP-YSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLA 307 (367)
T ss_dssp SCCT-TSGGGSTTCHHHHHHHTSHHHHHHHHHHHHHHHHHHHTTSCHHHHH
T ss_pred CCCC-cccccccccccccccccchhhHHHHHHHHHHHHHHHHhCCCHHHHH
Confidence 5332 222210 1 01112234567899999999999999985
|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* | Back alignment and structure |
|---|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* | Back alignment and structure |
|---|
| >4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* | Back alignment and structure |
|---|
| >3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* | Back alignment and structure |
|---|
| >4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* | Back alignment and structure |
|---|
| >2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A | Back alignment and structure |
|---|
| >2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} | Back alignment and structure |
|---|
| >2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A | Back alignment and structure |
|---|
| >1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A | Back alignment and structure |
|---|
| >1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 | Back alignment and structure |
|---|
| >1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A | Back alignment and structure |
|---|
| >2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} | Back alignment and structure |
|---|
| >2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* | Back alignment and structure |
|---|
| >3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A | Back alignment and structure |
|---|
| >3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A | Back alignment and structure |
|---|
| >2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A | Back alignment and structure |
|---|
| >2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} | Back alignment and structure |
|---|
| >1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A | Back alignment and structure |
|---|
| >3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* | Back alignment and structure |
|---|
| >3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* | Back alignment and structure |
|---|
| >1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* | Back alignment and structure |
|---|
| >3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* | Back alignment and structure |
|---|
| >2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} | Back alignment and structure |
|---|
| >3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} | Back alignment and structure |
|---|
| >2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A | Back alignment and structure |
|---|
| >2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* | Back alignment and structure |
|---|
| >3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 308 | ||||
| d1lqaa_ | 346 | c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: | 6e-35 | |
| d1pyfa_ | 311 | c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu | 3e-26 | |
| d3eaua1 | 326 | c.1.7.1 (A:36-361) Voltage-dependent K+ channel be | 2e-24 | |
| d1us0a_ | 314 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 2e-19 | |
| d1s1pa_ | 315 | c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak | 3e-19 | |
| d1hqta_ | 324 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 4e-18 | |
| d1afsa_ | 319 | c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase | 2e-17 | |
| d1gvea_ | 324 | c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) | 1e-15 | |
| d1mzra_ | 274 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 7e-15 | |
| d1qwka_ | 312 | c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod | 2e-14 | |
| d1pz1a_ | 333 | c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu | 4e-14 | |
| d1frba_ | 315 | c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce | 4e-13 | |
| d1ur3m_ | 298 | c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc | 4e-13 | |
| d1mi3a_ | 319 | c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu | 1e-12 | |
| d1vp5a_ | 284 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 1e-11 | |
| d1hw6a_ | 262 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 3e-08 |
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Tas protein species: Escherichia coli [TaxId: 562]
Score = 127 bits (320), Expect = 6e-35
Identities = 66/289 (22%), Positives = 114/289 (39%), Gaps = 36/289 (12%)
Query: 47 LSASPMGFGTWAWGNQFLWGYQESMDSQLQQTFNLAVENGINLFDTADSYGTG---RLNG 103
L S +G GT +G Q + ++ + AV GINL D A+ Y G
Sbjct: 11 LEVSTLGLGTMTFGEQ-------NSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQG 63
Query: 104 KSEKLLGKFISEIPGQKQVQNNIVIA------TKFAAYPWRLTPGQFVNACRASLARLQI 157
+E +G ++++ ++++ ++ K L A SL RLQ
Sbjct: 64 LTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKRLQT 123
Query: 158 EQIGIGQLHWS--------------TANYAPPQELALWNGLVAMYEKGLVRAVGVSNYGP 203
+ + + Q+HW T + L + L G +R +GVSN
Sbjct: 124 DYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSNETA 183
Query: 204 NQLVKIHDYLTARGVP-LCSAQVQFSLLSMGENQLEIKNICDSLGIRLISYSPLGLGMLT 262
+++ +P + + Q +SLL+ ++ + + G+ L++YS LG G LT
Sbjct: 184 FGVMRYLHLADKHDLPRIVTIQNPYSLLNR-SFEVGLAEVSQYEGVELLAYSCLGFGTLT 242
Query: 263 GKYTPSKLPRGPRALLFRQILPG----LKPLLRSLKEIAERRGKTIPQL 307
GKY P G R LF + + + + +IA R G Q+
Sbjct: 243 GKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARRHGLDPAQM 291
|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 308 | |||
| d1lqaa_ | 346 | Tas protein {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1pyfa_ | 311 | Putative oxidoreductase IolS {Bacillus subtilis [T | 100.0 | |
| d1gvea_ | 324 | Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus | 100.0 | |
| d1pz1a_ | 333 | Putative oxidoreductase YhdN {Bacillus subtilis [T | 100.0 | |
| d3eaua1 | 326 | Voltage-dependent K+ channel beta subunit {Rat (Ra | 100.0 | |
| d1ur3m_ | 298 | Hypothetical oxidoreductase YdhF {Escherichia coli | 100.0 | |
| d1hw6a_ | 262 | 2,5-diketo-D-gluconic acid reductase A {Corynebact | 100.0 | |
| d1s1pa_ | 315 | Prostaglandin d2 11-ketoreductase (akr1c3) {Human | 100.0 | |
| d1qwka_ | 312 | Hypothetical protein C07D8.6 {Nematode (Caenorhabd | 100.0 | |
| d1afsa_ | 319 | 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus | 100.0 | |
| d1mzra_ | 274 | 2,5-diketo-D-gluconic acid reductase A {Escherichi | 100.0 | |
| d1mi3a_ | 319 | Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 | 100.0 | |
| d1us0a_ | 314 | Aldose reductase (aldehyde reductase) {Human (Homo | 100.0 | |
| d1hqta_ | 324 | Aldose reductase (aldehyde reductase) {Pig (Sus sc | 100.0 | |
| d1vp5a_ | 284 | 2,5-diketo-D-gluconic acid reductase A {Thermotoga | 100.0 | |
| d1frba_ | 315 | FR-1 (fibroblast growth factor-induced) protein {M | 100.0 | |
| d1sjda1 | 242 | N-acylamino acid racemase {Amycolatopsis sp. [TaxI | 88.77 | |
| d2chra1 | 244 | Chlormuconate cycloisomerase {Alcaligenes eutrophu | 86.99 | |
| d1r0ma1 | 243 | N-acylamino acid racemase {Deinococcus radiodurans | 84.88 | |
| d1wufa1 | 244 | N-acylamino acid racemase {Listeria innocua [TaxId | 83.15 | |
| d1jpma1 | 234 | L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: | 81.77 |
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Tas protein species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=1.8e-49 Score=365.77 Aligned_cols=259 Identities=25% Similarity=0.384 Sum_probs=211.1
Q ss_pred cceeecC--CceeCcceeccCccCCCCcCCCCCCcHHHHHHHHHHHHHcCCCceeCCcCCCCCC---CCCchHHHHHHHH
Q 021767 39 WEKVKMG--PLSASPMGFGTWAWGNQFLWGYQESMDSQLQQTFNLAVENGINLFDTADSYGTGR---LNGKSEKLLGKFI 113 (308)
Q Consensus 39 m~~~~lg--g~~vs~lglG~~~~g~~~~~~~~~~~~~~~~~~l~~A~e~Gi~~~DtA~~Yg~~~---~~g~sE~~lG~~L 113 (308)
|+||+|| |++||+||||||+||+. .+++++.++|+.|++.|||+||||+.||.++ ..|.+|..+|+++
T Consensus 1 M~yr~lG~tgl~vs~iglGt~~~g~~-------~~~~~a~~~l~~A~~~Gin~~DTA~~Yg~~~~~~~~G~~E~~~g~~~ 73 (346)
T d1lqaa_ 1 MQYHRIPHSSLEVSTLGLGTMTFGEQ-------NSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQGLTETYVGNWL 73 (346)
T ss_dssp CCEEECTTSSCEEESEEEECTTBTTT-------BCHHHHHHHHHHHHHTTCCEEECCTTCSSSCCTTTTTHHHHHHHHHH
T ss_pred CCCeECCCCCCEecCeeEeCccCCCC-------CCHHHHHHHHHHHHHcCCCEEEcccccCCCcccccccchhhhhcchh
Confidence 8999999 99999999999998753 4678899999999999999999999999643 4699999999999
Q ss_pred hhCCCCCCCCCCEEEEeccCCC---------CCCCChHHHHHHHHHHHHhhCCCcccEEEecCCCCCC------------
Q 021767 114 SEIPGQKQVQNNIVIATKFAAY---------PWRLTPGQFVNACRASLARLQIEQIGIGQLHWSTANY------------ 172 (308)
Q Consensus 114 ~~~~~~~~~R~~v~i~tK~~~~---------~~~~~~~~i~~~~e~sL~~L~~d~iDl~~lH~~~~~~------------ 172 (308)
+... ..........+.+.. .+..+++.+++++++||+|||+||||+|++|||+...
T Consensus 74 ~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~SL~rL~~d~iDl~~lH~~d~~~~~~~~~~~~~~~ 150 (346)
T d1lqaa_ 74 AKHG---SREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTD 150 (346)
T ss_dssp HHHC---CGGGCEEEEEECCSCCTTCCCSSTTCCSSHHHHHHHHHHHHHHHTSSCEEEEEECSCSSCCSCTTCCSCCCCS
T ss_pred hhcc---ccceeeeeecccCCCccccccccccccccHHHHHHHHHHHHHHhCCCeeeeeehhccCccccccccccccccc
Confidence 8753 122233333332211 2345899999999999999999999999999986321
Q ss_pred --CChhHHHHHHHHHHHHHcCCccEEEeecCCHHHHHHHHHHHHHcCC-CceeeeeccCcccCCcchhhHHHHHHHhCCc
Q 021767 173 --APPQELALWNGLVAMYEKGLVRAVGVSNYGPNQLVKIHDYLTARGV-PLCSAQVQFSLLSMGENQLEIKNICDSLGIR 249 (308)
Q Consensus 173 --~~~~~~~~~~~l~~l~~~G~ir~iGvSn~~~~~l~~~~~~~~~~~~-~~~~~Q~~~~~~~~~~~~~~l~~~~~~~gi~ 249 (308)
......++|++|++|+++||||+||||||+.+++.++++.+...+. +++++|++||++++..+. +++++|+++||.
T Consensus 151 ~~~~~~~~~~~~~l~~l~~~G~ir~iGvS~~~~~~~~~~~~~~~~~~~~~~~~~q~~yn~~~~~~e~-~~~~~~~~~~i~ 229 (346)
T d1lqaa_ 151 SAPAVSLLDTLDALAEYQRAGKIRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEV-GLAEVSQYEGVE 229 (346)
T ss_dssp SCCSSCHHHHHHHHHHHHHTTSEEEEEEESCCHHHHHHHHHHHHHHTCCCCCEEEEECBTTBCTHHH-HHHHHHHHHCCE
T ss_pred ccccccHHHHHHHHHHHHhCCCeeEEEEeccCHHHHHHHHHHhhhcCCCCeEEEeCCCccccchHHH-HHHHHHHHhCCe
Confidence 1224567999999999999999999999999999999988776664 699999999999988665 999999999999
Q ss_pred EEEcccccccccCCCCCCCCCCCCchhhhhh----ccccChHHHHHHHHHHHHHhCCCcccCC
Q 021767 250 LISYSPLGLGMLTGKYTPSKLPRGPRALLFR----QILPGLKPLLRSLKEIAERRGKTIPQLL 308 (308)
Q Consensus 250 v~a~spl~~G~L~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~l~~ia~~~g~s~aqva 308 (308)
+++|+||++|+|+++|.....|......... .......++++.+.++|++||+|++|||
T Consensus 230 v~a~~pl~~G~Ltg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~g~s~aq~a 292 (346)
T d1lqaa_ 230 LLAYSCLGFGTLTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARRHGLDPAQMA 292 (346)
T ss_dssp EEEECTTGGGGGGTTTGGGCCCTTCHHHHCTTCCTTCSHHHHHHHHHHHHHHHHTTCCHHHHH
T ss_pred EEEecccccccccCCccCCCCCccccccccchhhhhhHHHHHHHHHHHHHHHHHHCcCHHHHH
Confidence 9999999999999999776554433222221 1334566788899999999999999975
|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} | Back information, alignment and structure |
|---|
| >d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} | Back information, alignment and structure |
|---|
| >d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|