Citrus Sinensis ID: 021768

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MGKQKKSRVSHEEEELNQENLNRSSSNDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWAKKVSETKPPTSPLKRKAKSNKQSESDLYAVISERRSDRKDRFDSMFSSLVSKYGGAAAGSEPTDEEFEAAQKKIENRRASKKSRRK
cccccccccccHHHHHHHHHHccccccccccHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHcccccccccccHHHHHHcccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccc
ccccccccccccccccccccccHHHcccccHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccccccccccHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcHHHccccc
mgkqkksrvSHEEEELNqenlnrsssndkdlYEVLGVERTASQQEIKKAYYKLALRlhpdknpgdevrRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQQLQKVISILGDEEKralydqtgcvddadlaGDVVQNLKEFFGAMYKKVTEADIEEFeanyrgsdsekKDLIDLYKKYKGNMNRLFCSMlcsdqkldshrFKDILDETIAAGELKATKAYQKWAKKvsetkpptsplkrkaksnkqsESDLYAVISERrsdrkdrfDSMFSSLVSkyggaaagseptdEEFEAAQKKIENRRaskksrrk
mgkqkksrvsheeeelnqenlnrsssndkdLYEVLGVERTASQQEIKKAYYKLALrlhpdknpgdEVRRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEfeanyrgsdsekkdLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWakkvsetkpptsplkrkaksnkqsesdlyaviserrsdrkdrfDSMFSSLVSKYGGAAAGSEPTDEEFEAAQKKienrraskksrrk
MGKQKKSRVsheeeelnqenlnrsssnDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEkkdlidlykkykGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWAKKVSETKPPTSPLKRKAKSNKQSESDLYAVISERRSDRKDRFDSMFSSLVSKYGGAAAGSEPTDEEFEAAQKKIENRRASKKSRRK
*******************************YEVLGVE*****QEIKKAYYKLALRLHP*******VRRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYR******KDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKW***************************************************************************************
***************************DKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDE*********GRSFLFS*********QEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYK********************KKDLIDLYKKYKGNMNRLFCSMLCSD**L**HRFKDILDETIAAGELKATKA*******************************************************************************************
**********************RSSSNDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAY***************************ESDLYAVISERRSDRKDRFDSMFSSLVSK**********************************
*********************N***SNDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWAKKVSETK***************SESDLYAVISERRSDRKDRFDSMFSSLVSKYGGA******************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKQKKSRVSHEEEELNQENLNRSSSNDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWAKKVSETKPPTSPLKRKAKSNKQSESDLYAVISERRSDRKDRFDSMFSSLVSKYGGAAAGSEPTDEEFEAAQKKIENRRASKKSRRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query308 2.2.26 [Sep-21-2011]
Q9FL54284 Chaperone protein dnaJ 6 no no 0.905 0.982 0.610 2e-92
Q91WN1259 DnaJ homolog subfamily C yes no 0.75 0.891 0.285 5e-27
Q8WXX5260 DnaJ homolog subfamily C yes no 0.714 0.846 0.295 7e-26
Q9VGR7299 J domain-containing prote yes no 0.724 0.745 0.305 7e-25
Q9UTQ5282 Uncharacterized J domain- yes no 0.535 0.585 0.291 2e-14
Q9QYI7227 DnaJ homolog subfamily B no no 0.418 0.568 0.331 4e-13
Q8RB67 384 Chaperone protein DnaJ OS yes no 0.217 0.174 0.440 1e-12
B8F7S3 378 Chaperone protein DnaJ OS yes no 0.217 0.177 0.419 5e-12
A5CD86 377 Chaperone protein DnaJ OS yes no 0.220 0.180 0.414 7e-12
A1KR91 373 Chaperone protein DnaJ OS yes no 0.224 0.184 0.410 7e-12
>sp|Q9FL54|DNAJ6_ARATH Chaperone protein dnaJ 6 OS=Arabidopsis thaliana GN=ATJ6 PE=1 SV=1 Back     alignment and function desciption
 Score =  338 bits (868), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 191/313 (61%), Positives = 236/313 (75%), Gaps = 34/313 (10%)

Query: 1   MGKQKKSRVSH-EEEELNQENLNRSSSNDKDLYEVLGVERTASQQEIKKAYYKLALRLHP 59
           MG++KKSR S  EE+E+  +N   SS     LYEVLGVER A+ QEI+KAY+KLAL+LHP
Sbjct: 1   MGRKKKSRASTTEEDEIEMDNAGPSSETS--LYEVLGVERRATSQEIRKAYHKLALKLHP 58

Query: 60  DKNPGDEVRRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQQLQKVISILGDEEKRALYDQ 119
           DKN  D                          +EAK+KFQQLQKVISILGDEEKRA+YDQ
Sbjct: 59  DKNQDD--------------------------KEAKDKFQQLQKVISILGDEEKRAVYDQ 92

Query: 120 TGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGN 179
           TG +DDAD+ GD  +NL++FF  MYKKV EADIEEFEANYRGS+SEKKDL++L+ K+KG 
Sbjct: 93  TGSIDDADIPGDAFENLRDFFRDMYKKVNEADIEEFEANYRGSESEKKDLLELFNKFKGK 152

Query: 180 MNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWAKKVSETKPPTSPLKRKA 239
           MNRLFCSMLCSD KLDSHRFKD+LDE IAAGE+K++KAY+KWA K+SETKPPTSPL+++ 
Sbjct: 153 MNRLFCSMLCSDPKLDSHRFKDMLDEAIAAGEVKSSKAYEKWANKISETKPPTSPLRKRK 212

Query: 240 KSNKQ---SESDLYAVISERRSDRKDRFDSMFSSLVSKYGGAAAGSEPTDEEFEAAQKKI 296
           K       SE+DL  +I++R+ +RK + DSMFSSL+S+YGG A     T+EEFEAAQ++I
Sbjct: 213 KKKSAAKDSETDLCLMIAKRQEERKGKVDSMFSSLISRYGGDAEAEP-TEEEFEAAQRRI 271

Query: 297 EN-RRASKKSRRK 308
           E+ R+ SKKSR K
Sbjct: 272 ESKRKPSKKSRGK 284
Have a continuous role in plant development probably in the structural organization of compartments.
Arabidopsis thaliana (taxid: 3702)
>sp|Q91WN1|DNJC9_MOUSE DnaJ homolog subfamily C member 9 OS=Mus musculus GN=Dnajc9 PE=2 SV=2 Back     alignment and function description
>sp|Q8WXX5|DNJC9_HUMAN DnaJ homolog subfamily C member 9 OS=Homo sapiens GN=DNAJC9 PE=1 SV=1 Back     alignment and function description
>sp|Q9VGR7|Y6693_DROME J domain-containing protein CG6693 OS=Drosophila melanogaster GN=CG6693 PE=1 SV=1 Back     alignment and function description
>sp|Q9UTQ5|YL39_SCHPO Uncharacterized J domain-containing protein C1071.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1071.09c PE=3 SV=1 Back     alignment and function description
>sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 Back     alignment and function description
>sp|Q8RB67|DNAJ_THETN Chaperone protein DnaJ OS=Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B8F7S3|DNAJ_HAEPS Chaperone protein DnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A5CD86|DNAJ_ORITB Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Boryong) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A1KR91|DNAJ_NEIMF Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
147843683 973 hypothetical protein VITISV_040411 [Viti 0.915 0.289 0.735 1e-126
225441724291 PREDICTED: chaperone protein dnaJ 6 [Vit 0.915 0.969 0.735 1e-126
449437611282 PREDICTED: chaperone protein dnaJ 6-like 0.879 0.960 0.745 1e-121
449501888282 PREDICTED: chaperone protein dnaJ 6-like 0.879 0.960 0.742 1e-119
356500485280 PREDICTED: chaperone protein dnaJ 6-like 0.905 0.996 0.718 1e-119
356572054278 PREDICTED: chaperone protein dnaJ 6-like 0.889 0.985 0.703 1e-115
255571604258 Chaperone protein dnaJ, putative [Ricinu 0.772 0.922 0.796 1e-115
224137970292 predicted protein [Populus trichocarpa] 0.853 0.900 0.724 1e-115
357509793275 Chaperone protein dnaJ [Medicago truncat 0.847 0.949 0.737 1e-114
224120374287 predicted protein [Populus trichocarpa] 0.915 0.982 0.699 1e-114
>gi|147843683|emb|CAN81991.1| hypothetical protein VITISV_040411 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 233/317 (73%), Positives = 259/317 (81%), Gaps = 35/317 (11%)

Query: 1   MGKQKKSRVS----HEEEELNQ-----ENLNRSSSNDKDLYEVLGVERTASQQEIKKAYY 51
           MGK+KK+RVS     E+E + Q     E +++SS+N++ LYEVLGVE+TASQQEIKKAYY
Sbjct: 1   MGKKKKTRVSDNIAEEKEYVGQSSKEEEYVSQSSTNERSLYEVLGVEKTASQQEIKKAYY 60

Query: 52  KLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQQLQKVISILGDE 111
           KLALRLHPDKNPGDE                          EAKEKFQQLQKVISILGDE
Sbjct: 61  KLALRLHPDKNPGDE--------------------------EAKEKFQQLQKVISILGDE 94

Query: 112 EKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEKKDLID 171
           EKRALYDQTGCVDDADLAG+VVQNL EFF  MYKKVTEADIEEFEANYRGSDSEK DLID
Sbjct: 95  EKRALYDQTGCVDDADLAGEVVQNLHEFFRTMYKKVTEADIEEFEANYRGSDSEKNDLID 154

Query: 172 LYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWAKKVSETKPP 231
           LYKK KGNMNRLFCSMLCSD KLDSHRFKDILDE I AGELKATK YQKWAK+VSE KPP
Sbjct: 155 LYKKCKGNMNRLFCSMLCSDPKLDSHRFKDILDEAIXAGELKATKVYQKWAKQVSEAKPP 214

Query: 232 TSPLKRKAKSNKQSESDLYAVISERRSDRKDRFDSMFSSLVSKYGGAAAGSEPTDEEFEA 291
           TSPL+++ KSNK+SESDL A+IS RRS+RKDRFDSMFSSLVSKYGG+   SEPT+EEFEA
Sbjct: 215 TSPLRKRGKSNKESESDLLAIISXRRSERKDRFDSMFSSLVSKYGGSGQVSEPTEEEFEA 274

Query: 292 AQKKIENRRASKKSRRK 308
            Q+K+E+ +ASKKS+RK
Sbjct: 275 TQRKLESLKASKKSKRK 291

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225441724|ref|XP_002283060.1| PREDICTED: chaperone protein dnaJ 6 [Vitis vinifera] gi|297739705|emb|CBI29887.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449437611|ref|XP_004136585.1| PREDICTED: chaperone protein dnaJ 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449501888|ref|XP_004161485.1| PREDICTED: chaperone protein dnaJ 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356500485|ref|XP_003519062.1| PREDICTED: chaperone protein dnaJ 6-like [Glycine max] Back     alignment and taxonomy information
>gi|356572054|ref|XP_003554185.1| PREDICTED: chaperone protein dnaJ 6-like [Glycine max] Back     alignment and taxonomy information
>gi|255571604|ref|XP_002526748.1| Chaperone protein dnaJ, putative [Ricinus communis] gi|223533937|gb|EEF35662.1| Chaperone protein dnaJ, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224137970|ref|XP_002322697.1| predicted protein [Populus trichocarpa] gi|222867327|gb|EEF04458.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357509793|ref|XP_003625185.1| Chaperone protein dnaJ [Medicago truncatula] gi|124360117|gb|ABN08133.1| Heat shock protein DnaJ [Medicago truncatula] gi|355500200|gb|AES81403.1| Chaperone protein dnaJ [Medicago truncatula] gi|388492410|gb|AFK34271.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224120374|ref|XP_002331032.1| predicted protein [Populus trichocarpa] gi|222872962|gb|EEF10093.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
TAIR|locus:2082189262 AT3G12170 [Arabidopsis thalian 0.704 0.828 0.688 3.8e-93
TAIR|locus:2169449284 ATJ6 "AT5G06910" [Arabidopsis 0.704 0.764 0.675 1.5e-89
UNIPROTKB|E1C8S9260 DNAJC9 "Uncharacterized protei 0.629 0.746 0.334 1.3e-34
ZFIN|ZDB-GENE-040718-130252 dnajc9 "DnaJ (Hsp40) homolog, 0.623 0.761 0.34 7.1e-34
FB|FBgn0037878299 CG6693 [Drosophila melanogaste 0.694 0.715 0.294 2.9e-29
MGI|MGI:1915326259 Dnajc9 "DnaJ (Hsp40) homolog, 0.626 0.745 0.290 2.9e-29
UNIPROTKB|F1MTK0261 DNAJC9 "Uncharacterized protei 0.590 0.697 0.309 5.9e-29
UNIPROTKB|Q8WXX5260 DNAJC9 "DnaJ homolog subfamily 0.616 0.730 0.292 7.6e-29
RGD|1305009259 Dnajc9 "DnaJ (Hsp40) homolog, 0.620 0.737 0.288 5.2e-28
UNIPROTKB|G4NCV1324 MGG_01016 "Chaperone dnaJ 6" [ 0.422 0.401 0.310 3.5e-22
TAIR|locus:2082189 AT3G12170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 787 (282.1 bits), Expect = 3.8e-93, Sum P(2) = 3.8e-93
 Identities = 150/218 (68%), Positives = 186/218 (85%)

Query:    91 EQEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEA 150
             +++AKEKFQQLQKVISILGDEEKRA+YDQTG VDDADL+GDVV NL++FF AMYKKVTE 
Sbjct:    46 DEDAKEKFQQLQKVISILGDEEKRAVYDQTGSVDDADLSGDVVDNLRDFFKAMYKKVTEE 105

Query:   151 DIEEFEANYRGSDSEXXXXXXXXXXXXGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAG 210
             DIEEFEANYRGS+SE            G M+RLFCSMLCS+ KLDSHRFKDI+DE IAAG
Sbjct:   106 DIEEFEANYRGSESEKNDLIELYNKFKGKMSRLFCSMLCSNPKLDSHRFKDIIDEAIAAG 165

Query:   211 ELKATKAYQKWAKKVSETKPPTSPLKRKAKSNKQSESDLYAVISERRSDRKDRFDSMFSS 270
             E+K+TKAY+KWAK+++E +PPT+P K + K+ K ++ DLYAV+S+R  +RK++FDSMFSS
Sbjct:   166 EVKSTKAYKKWAKEIAEMEPPTNPQKMRRKAAKAADKDLYAVMSQRGDERKEKFDSMFSS 225

Query:   271 LVSKYGGAAAGSEPTDEEFEAAQKKIENRRASKKSRRK 308
             LVS+YG + A SEP +EEFEAAQ+K+E+RR+SKKSR+K
Sbjct:   226 LVSRYG-SNADSEPNEEEFEAAQRKVESRRSSKKSRKK 262
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0048451 "petal formation" evidence=RCA
GO:0048453 "sepal formation" evidence=RCA
TAIR|locus:2169449 ATJ6 "AT5G06910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8S9 DNAJC9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-130 dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0037878 CG6693 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1915326 Dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTK0 DNAJC9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WXX5 DNAJC9 "DnaJ homolog subfamily C member 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305009 Dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G4NCV1 MGG_01016 "Chaperone dnaJ 6" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 9e-23
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-21
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 2e-21
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 7e-19
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-17
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 6e-17
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 8e-17
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-16
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-16
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 2e-16
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-16
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 3e-16
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 5e-16
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 8e-16
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 2e-15
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-15
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 2e-15
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 3e-15
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 4e-15
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 8e-15
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 7e-14
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-13
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 3e-13
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 8e-13
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 6e-12
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 1e-11
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 2e-11
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 1e-10
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 2e-10
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 2e-10
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 3e-10
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 6e-10
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-09
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 6e-09
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 3e-08
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 4e-07
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 5e-06
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 9e-05
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 96.5 bits (241), Expect = 9e-23
 Identities = 39/93 (41%), Positives = 53/93 (56%), Gaps = 26/93 (27%)

Query: 29  KDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFI 88
           +D YE+LGV + AS++EIKKAY KLA + HPD+NPGD+                      
Sbjct: 4   RDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDK---------------------- 41

Query: 89  FFEQEAKEKFQQLQKVISILGDEEKRALYDQTG 121
               EA+EKF+++ +   +L D EKRA YDQ G
Sbjct: 42  ----EAEEKFKEINEAYEVLSDPEKRAAYDQFG 70

Length = 371
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.92
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.88
PRK14288 369 chaperone protein DnaJ; Provisional 99.84
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.84
PRK14296 372 chaperone protein DnaJ; Provisional 99.82
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.82
PRK14287 371 chaperone protein DnaJ; Provisional 99.8
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.8
PRK14286 372 chaperone protein DnaJ; Provisional 99.8
PRK14298 377 chaperone protein DnaJ; Provisional 99.79
PRK14285365 chaperone protein DnaJ; Provisional 99.78
PRK14299291 chaperone protein DnaJ; Provisional 99.78
PRK14294 366 chaperone protein DnaJ; Provisional 99.77
PRK14276 380 chaperone protein DnaJ; Provisional 99.77
PRK14301 373 chaperone protein DnaJ; Provisional 99.77
PRK14297 380 chaperone protein DnaJ; Provisional 99.77
PRK14279 392 chaperone protein DnaJ; Provisional 99.77
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
PRK14278 378 chaperone protein DnaJ; Provisional 99.77
PRK14282 369 chaperone protein DnaJ; Provisional 99.76
PRK10767 371 chaperone protein DnaJ; Provisional 99.76
PRK14277 386 chaperone protein DnaJ; Provisional 99.76
PRK14280 376 chaperone protein DnaJ; Provisional 99.75
PRK14291 382 chaperone protein DnaJ; Provisional 99.74
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.74
PRK14281 397 chaperone protein DnaJ; Provisional 99.74
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.73
PRK14283 378 chaperone protein DnaJ; Provisional 99.73
PRK14290 365 chaperone protein DnaJ; Provisional 99.72
PRK14284 391 chaperone protein DnaJ; Provisional 99.72
PRK14295 389 chaperone protein DnaJ; Provisional 99.71
PRK14292 371 chaperone protein DnaJ; Provisional 99.71
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.71
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.71
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
PRK14293 374 chaperone protein DnaJ; Provisional 99.7
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
PRK14289 386 chaperone protein DnaJ; Provisional 99.69
PRK14300 372 chaperone protein DnaJ; Provisional 99.69
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.61
PHA03102153 Small T antigen; Reviewed 99.6
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.59
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.59
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.57
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.55
PHA02624 647 large T antigen; Provisional 99.53
PRK01356166 hscB co-chaperone HscB; Provisional 99.48
PRK05014171 hscB co-chaperone HscB; Provisional 99.47
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.46
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.46
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.44
PRK00294173 hscB co-chaperone HscB; Provisional 99.42
PRK03578176 hscB co-chaperone HscB; Provisional 99.42
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.38
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.31
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.3
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.22
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.1
PTZ00100116 DnaJ chaperone protein; Provisional 99.1
PRK01773173 hscB co-chaperone HscB; Provisional 99.08
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.94
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.92
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.14
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 97.87
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.19
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 96.87
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.73
KOG0431453 consensus Auxilin-like protein and related protein 96.59
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.9
KOG0724335 consensus Zuotin and related molecular chaperones 93.51
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 83.3
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1e-56  Score=407.20  Aligned_cols=248  Identities=58%  Similarity=0.919  Sum_probs=221.4

Q ss_pred             CCCccccccccCccCCCCHHHHHHHHHHHHHHhCCCCCCCchhhhhhccccCCccchhhhhhhhhhhHHHHHHHHHHHHH
Q 021768           25 SSNDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQQLQKV  104 (308)
Q Consensus        25 ~~~~~d~YeVLgV~~~As~~eIKkAYrklal~~HPDK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~F~~I~~A  104 (308)
                      ...+.|+|+||||.++|+..+|++||++|+|+||||+++...                        ..+|+..|++|+.|
T Consensus        10 ~f~~~d~YevLGVer~a~~~eIrkAY~klal~~HPDk~~eed------------------------~~ea~~kFq~l~k~   65 (264)
T KOG0719|consen   10 SFNKKDLYEVLGVERDATDKEIRKAYHKLALRLHPDKNHEED------------------------KVEATEKFQQLQKA   65 (264)
T ss_pred             cccccCHHHHhhhcccCCHHHHHHHHHHHHHHhCCCcchhhh------------------------HHHHHHHHHHHHHH
Confidence            345679999999999999999999999999999999997332                        34899999999999


Q ss_pred             HHHcCChhHHHHhhccCCCCCCCCCchhhccHHHHHHHhhccCChHhHHhhhhccCCCchhhhhHHHHHHHhcchhhhHH
Q 021768          105 ISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGNMNRLF  184 (308)
Q Consensus       105 YevLsDp~~R~~YD~~G~~~~~~~~~~~~~~~~~~f~~~f~~~~~~di~~f~~~y~gs~ee~~dl~~~y~~~~G~~~~i~  184 (308)
                      |.||||.++|+.||++|..++  .+++.+.+|.+||+.+|..||.++|++|.+.|+||++|+.||+.+|++|+|+|.+||
T Consensus        66 y~iLsDeekR~~YDetG~idd--~~~d~~~~~~e~~~~iyk~VteedIeef~a~Y~gSEeEk~Dl~~~Y~k~kG~m~~i~  143 (264)
T KOG0719|consen   66 YQILSDEEKRAVYDETGSIDD--ESGDIDEDWLEFWRAIYKKVTEEDIEEFEANYQGSEEEKKDLLKLYNKFKGKMNRIL  143 (264)
T ss_pred             HHHhhHHHHHHHHhccCCCCC--ccchhhhHHHHHHHHHHhhcccccHHHHHHHhcccHHHHHHHHHHHHhcCChHHHHH
Confidence            999999999999999999974  457778899999999999999999999999999999999999999999999999999


Q ss_pred             hhhccccccCChhHHHHHHHHHHHcCCccchhhhHHHHhhhhcCCCCCChhhhh-hh--hhcCChhHHHHHHHHHHHhhH
Q 021768          185 CSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWAKKVSETKPPTSPLKRK-AK--SNKQSESDLYAVISERRSDRK  261 (308)
Q Consensus       185 ~~v~~s~~~~d~~R~~~ii~~~I~~ge~~~~~~~~~~~k~~~~~~~~~~~~~~k-~k--~~k~~~~~L~~li~~r~~~r~  261 (308)
                      ++||||++. |++||++||+.+|++|+|+.|+.|.+|+.+. +.++++.++..+ ++  ..+....||.++|++|+..|.
T Consensus       144 ~~~l~~d~~-De~R~keiid~~I~~Gev~~yK~y~~~~~~~-K~r~~~~~re~r~ak~~~~~~~~~DL~~~i~~r~~eRk  221 (264)
T KOG0719|consen  144 ESVLCSDPK-DEDRFKEIIDEAIADGEVKKYKAYEKWASEK-KMRAPKKAREKREAKVLAAKDNGIDLDAMIEKRGGERK  221 (264)
T ss_pred             HhhhcCCcc-cHHHHHHHHHHHHhcCCchhhhhcccchhhh-hhccccchHHHHHHHHHHHHhcCccHHHHHHHHhhhhh
Confidence            999999999 9999999999999999999999999999876 444443333322 22  245567899999999999999


Q ss_pred             hhHHHHHHHHHHHhCCCCCCCCCCHHHHHHHHHHHhhhhh
Q 021768          262 DRFDSMFSSLVSKYGGAAAGSEPTDEEFEAAQKKIENRRA  301 (308)
Q Consensus       262 ~~~~~~~~~Le~Ky~~~~~~~ep~eeef~~~q~~~~~~k~  301 (308)
                      .++++||++|++||++. ..+.|..++|.++|++.+.+++
T Consensus       222 ~~~~sl~~SL~~kY~~~-~~s~~~~~~~~aa~~~~ksk~~  260 (264)
T KOG0719|consen  222 GKFDSLLDSLEEKYGGN-ADSKPEREEFEAAQRPKKSKRS  260 (264)
T ss_pred             hhHHHHHHHHHHHhccc-cccchhhhhhhhhcCccccccc
Confidence            99999999999999986 4567999999999999877764

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 8e-13
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 3e-11
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 3e-11
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 3e-11
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 9e-11
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 6e-10
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 6e-10
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 1e-09
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 1e-09
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 2e-09
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 1e-08
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 2e-08
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 3e-08
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 1e-07
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 1e-07
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 4e-07
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 3e-06
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 6e-06
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 3e-05
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 4e-05
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 4e-05
2ys8_A90 Solution Structure Of The Dnaj-Like Domain From Hum 6e-05
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 1e-04
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 2e-04
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 5e-04
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 6e-04
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 54/93 (58%), Gaps = 25/93 (26%)
Query: 30  DLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFIF 89
           + YEVLGV+ +AS ++IKKAY KLALR HPDKNP +                        
Sbjct: 10  NYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDN------------------------ 45
Query: 90  FEQEAKEKFQQLQKVISILGDEEKRALYDQTGC 122
            ++EA++KF+ + +   +L D +KR+LYD+ GC
Sbjct: 46  -KEEAEKKFKLVSEAYEVLSDSKKRSLYDRAGC 77
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 9e-24
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 4e-23
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-22
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 4e-22
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-21
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 1e-21
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 2e-21
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 4e-21
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 5e-21
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 8e-21
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 1e-20
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 1e-20
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 3e-20
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-19
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 2e-19
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 4e-19
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 6e-19
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 2e-18
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 6e-18
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-17
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 4e-17
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 4e-16
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 2e-15
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 3e-15
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 7e-09
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 9e-08
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 7e-07
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 8e-06
2guz_A71 Mitochondrial import inner membrane translocase su 8e-06
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 4e-05
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-04
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 4e-04
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 8e-04
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
 Score = 94.1 bits (234), Expect = 9e-24
 Identities = 33/115 (28%), Positives = 48/115 (41%), Gaps = 22/115 (19%)

Query: 29  KDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFI 88
           KD Y +LG + +A+  ++K+ Y KL L  HPDK   D                       
Sbjct: 10  KDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGT------------------ 51

Query: 89  FFEQEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDV--VQNLKEFFG 141
              +E  +KF ++ +   ILG+EE +  YD   C DD    G V     L+E   
Sbjct: 52  --VEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSW 104
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.84
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.84
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.83
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.83
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.82
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.82
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.81
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.81
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.8
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.8
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.8
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.8
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.8
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.8
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.79
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.78
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.78
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.77
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.73
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.73
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.71
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.7
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.69
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.67
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.63
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.62
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.61
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.6
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.59
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.58
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.58
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.54
2guz_A71 Mitochondrial import inner membrane translocase su 99.49
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.03
2guz_B65 Mitochondrial import inner membrane translocase su 98.48
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 80.75
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
Probab=99.84  E-value=8.6e-22  Score=159.80  Aligned_cols=100  Identities=26%  Similarity=0.344  Sum_probs=81.0

Q ss_pred             hcCCCCCccccccccCccCCC-CHHHHHHHHHHHHHHhCCCCCCCchhhhhhccccCCccchhhhhhhhhhhHHHHHHHH
Q 021768           21 LNRSSSNDKDLYEVLGVERTA-SQQEIKKAYYKLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQ   99 (308)
Q Consensus        21 ~~~~~~~~~d~YeVLgV~~~A-s~~eIKkAYrklal~~HPDK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~F~   99 (308)
                      +........|||+||||+++| +.++|++|||+|+++||||++++...                       ...+.+.|+
T Consensus         7 l~~~~~~~~~~y~iLgv~~~a~s~~eIk~aYr~l~~~~HPDk~~~~~~-----------------------~~~a~~~f~   63 (109)
T 2qsa_A            7 APELYCGLENCYDVLEVNREEFDKQKLAKAYRALARKHHPDRVKNKEE-----------------------KLLAEERFR   63 (109)
T ss_dssp             CTTSTTTTSCHHHHTTCCGGGCCHHHHHHHHHHHHHHTCGGGCCSHHH-----------------------HHHHHHHHH
T ss_pred             HHHHHcCCCCHHHHcCCCCCCCCHHHHHHHHHHHHHHHCcCCCCCccc-----------------------cHHHHHHHH
Confidence            344455689999999999999 99999999999999999999986221                       236889999


Q ss_pred             HHHHHHHHcCChhHHHHhhccCCCCCCCCCchhhccHHHHHHHhhc-cCC
Q 021768          100 QLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYK-KVT  148 (308)
Q Consensus       100 ~I~~AYevLsDp~~R~~YD~~G~~~~~~~~~~~~~~~~~~f~~~f~-~~~  148 (308)
                      .|++||+||+||.+|+.||..|...     ++.+.+|.+||+.+|+ +++
T Consensus        64 ~i~~AY~~L~d~~~R~~YD~~~~~~-----~~~~~~~~~~~~~~~~~~~~  108 (109)
T 2qsa_A           64 VIATAYETLKDDEAKTNYDYYLDHP-----DQRFYNYYQYYRLRAAPKVD  108 (109)
T ss_dssp             HHHHHHHHHHSHHHHHHHHHHHHCT-----TCHHHHHHHHHHHC------
T ss_pred             HHHHHHHHHCCHHHHHHHHHhccCc-----hHHHHHHHHHHHHHhccccC
Confidence            9999999999999999999998542     2356789999999984 343
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 308
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-12
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 6e-12
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 6e-11
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 8e-11
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 2e-10
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 2e-08
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 4e-08
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 7e-08
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 60.5 bits (146), Expect = 1e-12
 Identities = 26/93 (27%), Positives = 40/93 (43%), Gaps = 20/93 (21%)

Query: 29  KDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFI 88
           KD Y +LG + +A+  ++K+ Y KL L  HPDK   D                       
Sbjct: 16  KDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSAD--------------------VPA 55

Query: 89  FFEQEAKEKFQQLQKVISILGDEEKRALYDQTG 121
              +E  +KF ++ +   ILG+EE +  YD   
Sbjct: 56  GTMEECMQKFIEIDQAWKILGNEETKKKYDLQR 88
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.87
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.82
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.81
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.69
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.65
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.62
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.58
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.87  E-value=7.4e-23  Score=154.73  Aligned_cols=70  Identities=49%  Similarity=0.884  Sum_probs=65.5

Q ss_pred             ccccccccCccCCCCHHHHHHHHHHHHHHhCCCCCCCchhhhhhccccCCccchhhhhhhhhhhHHHHHHHHHHHHHHHH
Q 021768           28 DKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEVRRKLSYLHGRSFLFSVVIYFIFFEQEAKEKFQQLQKVISI  107 (308)
Q Consensus        28 ~~d~YeVLgV~~~As~~eIKkAYrklal~~HPDK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~F~~I~~AYev  107 (308)
                      ..|||+||||+++||.++|++|||+++++||||+++++.                          .+...|+.|++||+|
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~--------------------------~~~~~f~~i~~Ay~v   55 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDK--------------------------EAEAKFKEIKEAYEV   55 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTC--------------------------HHHHHHHHHHHHHHH
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCCh--------------------------HHHHHHHHHHHHHHh
Confidence            479999999999999999999999999999999998765                          577899999999999


Q ss_pred             cCChhHHHHhhccCCC
Q 021768          108 LGDEEKRALYDQTGCV  123 (308)
Q Consensus       108 LsDp~~R~~YD~~G~~  123 (308)
                      |+||.+|..||.+|..
T Consensus        56 L~d~~~R~~YD~~g~~   71 (75)
T d1xbla_          56 LTDSQKRAAYDQYGHA   71 (75)
T ss_dssp             TTSSHHHHHHHHHTTS
T ss_pred             cCCHHHHHHHHHhCcc
Confidence            9999999999999964
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure