Citrus Sinensis ID: 021808

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------

MLGVSAVPAIIQFVLMLFMPESPRWLFMKSDKEKAILVLSKIYDIARLEDEIDHLSAAAEEELRKKKTVRYLDVFKSKEIRLAFLAGAGLQAFQQFTGINTVMYYSPTIVQMAGFQSNQLALLLSLAVAGTNAVGTIVGIYLIDHFGRKKLALSSLAGVIISLVLLSWAFISGSSASSSGVYGWIAVIGLALYIAFFAPGMGPVPWTLNSEVYPEQYRGICGGMSATVNWISNLIVAQTFLTVAELVGTGATFLILAGIAVLAVVFVILFVPETQGLTFLEVEQMWKERAWGSSLNTESLLEHGNSS

cccccHHHHHHHHHHHcccccccHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHcccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccHHHcccccc

xxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLGVSAVPAIIQFVLMLFMPESPRWLFMKSDKEKAILVLSKIYDxxxxxxxxxxxxxxxxxxxxxKKTVRYLDVFKSKEIRLAFLAGAGLQAFQQFTGINTVMYYSPTIVQMAGFQSNQLALLLSLAVAGTNAVGTIVGIYLIDHFGRKKLALSSLAGVIISLVLLSWAFISGSSASSSGVYGWIAVIGLALYIAFFAPGMGPVPWTLNSEVYPEQYRGICGGMSATVNWISNLIVAQTFLTVAELVGTGATFLILAGIAVLAVVFVILFVPETQGLTFLEVEQMWKERAWGSSLNTESLLEHGNSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Inositol transporter 1	Vacuolar inositol-proton symporter involved in the release of myo-inositol from vacuoles. Not involved in glucose or fructose transport.	probable	Q8VZR6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:very confident
Coverage over the Query: 3-287
View the alignment between query and template
View the model in PyMOL