Citrus Sinensis ID: 021811

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
MVKGALKEYGVSCELNLVEGSMTVSTTRKTRDPYIIVKARDLIRLLSRSVPAPQAIKILDDEMQCDIIKIGNLVRNKERFVKRRQHLVGPNSSTLKALEILTGCYILVQGNTVAAMGSFKGLKQVRRIVEDCMQNKMHPVYHIKILMVKKELEKDPALANENWDRFLPKFKKKNVKQKKVKSKEKKPYTPFPPPPQPSKIDKLLESGEYFLSERKKESKKWQEKQEKQAEKTAENKRKRDAAFIPPEEPSRQNSCEAEDKTNDVAAMAKSLKEKAKKLRKQKFAENINPEEYIAASGEKPSKKKKSK
cHHHHHHHHccEEEEEccccCEEEEcccccccHHHHHHHHHHHHHHHccccHHHHHHHHccccEEEEEEcccccccHHHHHHHHccccccccHHHHHHHHHHccEEEEEccEEEEEEccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccHHHHcHHHHHHcccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc
MVKGAL*EYGVSCELNLVEGSMTVSTTRKTRDPYIIVKARDLIRLLSRSVPAPQAIKILDDEMQCDIIKIGNLVRNKERFVKRRQHLVGPNSSTLKALEILTGCYILVQGNTVAAMGSFKGLKQVRRIVEDCMQNKMHPVYHIKILMVKKELEKDPALANENWDRFL**********************************KLLESGE***************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKGALKEYGVSCELNLVEGSMTVSTTRKTRDPYIIVKARDLIRLLSRSVPAPQAIKILDDEMQCDIIKIGNLVRNKERFVKRRQHLVGPNSSTLKALEILTGCYILVQGNTVAAMGSFKGLKQVRRIVEDCMQNKMHPVYHIKILMVKKELEKDPALANENWDRFLPKFKKKNVKQKKVKSKEKKPYTPFPPPPQPSKIDKLLESGEYFLSERKKESKKWQEKQEKQAEKTAENKRKRDAAFIPPEEPSRQNSCEAEDKxxxxxxxxxxxxxxxxxxxxxKFAENINPEEYIAASGEKPSKKKKSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
KRR1 small subunit processome component homolog Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly. Binds to RNA. Required for female germline development, cell viability during eye development and for survival of dividing cells and epithelial cells during early wing disk development.probableQ9VPU8
KRR1 small subunit processome component homolog Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.probableQ3B7L9
KRR1 small subunit processome component Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly. Essential for vegetative growth.probableP25586

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E3U, chain A
Confidence level:very confident
Coverage over the Query: 16-147
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 171-186,201-244
View the alignment between query and template
View the model in PyMOL