Citrus Sinensis ID: 021853

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------

MGTQTMGSEGDAAAQAKNMLSLTRQGSLYNLTLDEIQSQLGDRGKPLGSMNLDELLKSVWTAENNFHSEPALSLHRQGSLTLAQDLSNKTVDEVWKDIRQKKSDDNQENEAQARQTSLGEMTLEDFLIKAGAVNESTTPGQNNSGPGLEVDSIATVQQNVSQHAQWMQYQLPSVQLQPQHQHQHQNNLMAVYMPTHTIQQSLPITANPVLDAQYPDNQMTMSPSSLMGALSDTQTPGRKRVASGDVVEKTVERRQKRMIKNRESAARSRARKQAYTQELENKVSRLEEENERLRRQRVWFIFFFFS

cccccccccccccccccccccccccccccHHcHHHHHHHHcccccccccccHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHccccccHHHHHHHHcccccccccccccccccccccccHHHHccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc

***************************LYNLTLDEIQSQLGDRGKPLGSMNLDELLKSVWTAENN**************************DEV*******************************FLI***********************************AQWMQYQL*****QP*********LMAVYMPTHTIQQSLPITA********************************************************************YTQELENKVSRLEEENERLRRQRVWFIFFFFS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ABSCISIC ACID-INSENSITIVE 5-like protein 2	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.	probable	Q9LES3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DGC, chain A
Confidence level:confident
Coverage over the Query: 255-303
View the alignment between query and template
View the model in PyMOL