Citrus Sinensis ID: 021893

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MQAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLELDLPKMRKPKPADAPATPCHRCGRNLYG
ccEEEEEEccccccHHHHHHHccccccccccccccccccEEECcccHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHHHHcccEEEEEcccccccccccccHHcccccccHHHHHHHHccccccccEEEEEcHHHHcccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccEEEEEEccccccccHHHHHHHHHHcccEEccccccEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccc
MQAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLE*********************CGRNL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAIIVSCCGCFHGRTLAAISMSCDNEAIRGFGPLLPGHLKVDFGDITALEKIFKESGDQIAGFLFEPIQGEAGVIIPPDGYLKAVRDLCSKYNILMIADEIQSGLARSGRMLASDWEEVRPDMVILGKALGGGVIPVSAVLADKEVMLCIQPGEHGSTFGGNPLASAVAIASLDVIRDEKLAERSAHLGEELRQHLFKIQQQFPNYVKEVRGRGLFNAVEFDKTALPVSAYDICLKMKERGILAKPTHDTIVRLTPPLSISSNELQEGSKALHDVLELDLPKMRKPKPADAPATPCHRCGRNLYG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ornithine aminotransferase, mitochondrial Mediates degradation of arginine for nitrogen recycling. Plays a role in non-host disease resistance by regulating pyrroline-5-carboxylate metabolism-induced hypersensitive response.probableQ9FNK4
Ornithine aminotransferase, mitochondrial Confers drought and oxidative stress tolerance mainly through enhancing ROS-scavenging capacity and Pro pre-accumulation.probableQ10G56
Ornithine aminotransferase Catalyzes the interconversion of ornithine to glutamate semialdehyde.probableQ8EP32

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Z7D, chain A
Confidence level:very confident
Coverage over the Query: 3-11,38-282
View the alignment between query and template
View the model in PyMOL