Citrus Sinensis ID: 021896


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MDWDLQAIVRGCSTEASIDSVMDKPQSYNFSPSSLQQDVRFKFPDVSETTTILDELEELYKPFYPQTILTSTSISAPTEVNKKPKKLRKQQRKLSDSASNTDHPAAQPKGGKNQHKRVVQRVTADCLACDKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERSSADPGVFIITYGAEHNHGHPTRRSALAGSTRSKLASMSKAQGPAQNKPLEPASEASAELGDLVYQGNIKKEDENVFLDGQEIELVMPDLTFSDELMFPSLEDLEGFLLDQFPDHNINMSADDNSWFIDESVTLNGGL
cccccccEEccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MDWDLQAIVR************************************************************************************************************VQRVTADCLACDKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERSSADPGVFIITYGAEHNH********************************************************************************PS*EDLEGFLLDQFPDHNINMSADDNSWFIDESVT*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDWDLQAIVRGCSTEASIDSVMDKPQSYNFSPSSLQQDVRFKFPDVSETTTILDELEELYKPFYPQTILTSTSISAPTEVNKKPKKLRKQQRKLSDSASNTDHPAAQPKGGKNQHKRVVQRVTADCLACDKWAWRKYGQKPIKGSPYPRSYYRCSSSKGCLARKQVERSSADPGVFIITYGAEHNHGHPTRRSALAGSTRSKLASMSKAQGPAQNKPLEPASEASAELGDLVYQGNIKKEDENVFLDGQEIELVMPDLTFSDELMFPSLEDLEGFLLDQFPDHNINMSADDNSWFIDESVTLNGGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WRKY transcription factor 22 Transcription factor involved in the expression of defense genes in innate immune response of plants. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Activates WRKY 29, SIRK and its own promoters.probableO04609

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AYD, chain A
Confidence level:very confident
Coverage over the Query: 116-190
View the alignment between query and template
View the model in PyMOL