Citrus Sinensis ID: 021911

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----

MRPPRGRGGGGGFRGGRGDGGGRGRGGGRGGGGGRGGGSAMRGRGGGRGGGRGGGRGRGGGGMKGGSKVVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGARVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKAGGHFVISIKANCIDSTVPAEAVFQSEVKKLQQDQFKPFEQVTLEPFERDHACVVGGYRMPKKQKA

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEECcccEEEEEccccEEEEEcccccccccccEEEEEEcccccEEEEEEEcccHHHHHHHHHccccccccccccEEEEEccccccccccEEEEEccccEEEEEEcccHHHHHHHHHHcccccEEEEEcccccccccccccccEEEEEEccccccHHHHHHHHcccccccccEEEEEEEcccccccccHHHHHHHHHHHHHcccccccEEEEccccccccEEEEEEEcccccccc

************************************************************************PHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGARVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKAGGHFVISIKANCIDSTVPAEAVFQSEVKKLQQDQFKPFEQVTLEPFERDHACVVGGY*MP*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mediator of RNA polymerase II transcription subunit 36a	Involved in pre-rRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA.	confident	Q94AH9
rRNA 2'-O-methyltransferase fibrillarin	Involved in pre-rRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA.	probable	P22509
rRNA 2'-O-methyltransferase fibrillarin	Involved in pre-rRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA. Involved in the biogenesis of the 18S rRNA.	probable	P15646

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IPX, chain A
Confidence level:very confident
Coverage over the Query: 71-299
View the alignment between query and template
View the model in PyMOL