Citrus Sinensis ID: 021914

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----

MFGLKKSPLRVGRHNSVDPGHQVSSRSNPFDSDDELDNKQTLKPSKRTSSEPNLTTSKVSTNPFDDDDIKENTAVSSYSLTSAARNKYRNDFRDSGGLENQSVQELEDYAVYKAEDTTKQVHGCLKIAEEIREDATKTLVSLHQQGEQITRTHYTAASIDHDLSRGEKLLGSLGGMFSRTWKPKKTRPIMGPVITRDDPVQRRGNHLEQREKLGLNNTSKGQSNTRAQLPEPTDAYQKIEVEKSKQDDALSELSGILGELKNMATDMGSEIDRQNKSLDYLDDDVDVLNIRVKDANLRGRRLLGK

ccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHccccccHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc

*********************************************************************************************************LEDYAVYKAEDTTKQVHGCLKIAEEIREDATKTLVSLHQQGEQITRTHYTAASIDHDLSRGEKLLGSLGGMFSRTWKPKKTRPIMGPVITRDD*************************************YQKIEVEKSKQDDALSELSGILGELKNMATDMGSEIDRQNKSLDYLDDDVDVLNIRVKDANLRGRRLLG*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
SNAP25 homologous protein SNAP33	t-SNARE involved in diverse vesicle trafficking and membrane fusion processes, including cell plate formation. May function in the secretory pathway.	probable	Q9S7P9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1L4A, chain D
Confidence level:very confident
Coverage over the Query: 227-303
View the alignment between query and template
View the model in PyMOL

Template: 1L4A, chain C
Confidence level:confident
Coverage over the Query: 100-172
View the alignment between query and template
View the model in PyMOL