Citrus Sinensis ID: 021926


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MSDLKLRPEISFAQTFLCSAFAACFAELCTIPLDTAKVRLQLQKKTASGDGVSVSKYRGLMGTVVTIAREEGLWALWNGVIAGLHRQCIYGGLRIGLYDPVKTFLVGSDFVGDIPLYQKIFAALLTGAIAIVVANPTDLVKVRLQAEGKLPSGVPRRYYGALDAYCTIVRQEGLGALWTGLGPNIARNAIVNAAELASYDQVKETILKIPGFTDNIFTHILAGLGAGLFAVCIGSPIDVVKSRMMGDSAYKNTVDCFIKTLKYEGFLAFYKGFLPNFSRLGSWNVIMFLTLEQAKKVFIREVYFD
cccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHccHHcHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccHHHHHHHHHHHHcccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccc
********EISFAQTFLCSAFAACFAELCTIPLDTAKVRLQLQ********VSVSKYRGLMGTVVTIAREEGLWALWNGVIAGLHRQCIYGGLRIGLYDPVKTFLVGSDFVGDIPLYQKIFAALLTGAIAIVVANPTDLVKVRLQAEGKLPSGVPRRYYGALDAYCTIVRQEGLGALWTGLGPNIARNAIVNAAELASYDQVKETILKIPGFTDNIFTHILAGLGAGLFAVCIGSPIDVVKSRMMGDSAYKNTVDCFIKTLKYEGFLAFYKGFLPNFSRLGSWNVIMFLTLEQAKKVFIREVYF*
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDLKLRPEISFAQTFLCSAFAACFAELCTIPLDTAKVRLQLQKKTASGDGVSVSKYRGLMGTVVTIAREEGLWALWNGVIAGLHRQCIYGGLRIGLYDPVKTFLVGSDFVGDIPLYQKIFAALLTGAIAIVVANPTDLVKVRLQAEGKLPSGVPRRYYGALDAYCTIVRQEGLGALWTGLGPNIARNAIVNAAELASYDQVKETILKIPGFTDNIFTHILAGLGAGLFAVCIGSPIDVVKSRMMGDSAYKNTVDCFIKTLKYEGFLAFYKGFLPNFSRLGSWNVIMFLTLEQAKKVFIREVYFD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial uncoupling protein 2 PUMPS are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. This leads to a decrease in the efficiency of oxidative phosphorylation and an increase in heat production. May be involved in protecting plant cells against oxidative stress damage.confidentQ9ZWG1
Mitochondrial dicarboxylate transporter Mitochondrial dicarboxylic transporter catalyzing the exchange of dicarboxylic acids like malate and succinate for inorganic phosphate. Required for growth on ethanol and acetate.probableQ06143
Mitochondrial uncoupling protein 3 UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. As a result, energy is dissipated in the form of heat. May play a role in the modulation of tissue respiratory control. Participates in thermogenesis and energy balance.probableP56501

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 14-300
View the alignment between query and template
View the model in PyMOL