Citrus Sinensis ID: 021930


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MEAAAKVKSIFVYPIKSCRGISVCQQAPLTPTGFRWDRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQALKISLSKPRDIADGVSVWEWCGSALAEGAEASNWFTNYLGKPSRLVRYNAESETRPVDPKYAAGEKIMFSDCYPFMLLSQGSLDALNKLLKEPIPINRFRPNILVDGCEPFSEDTWTEVRINKFTFQGVKLCSRCKIPTINQDTGDAGPEPNETLKQIRSDKVLRPGRKQRGKIYFGQNMVCKDNLTEGNGKVLKLGDPVFVLKKVTSAAEAAA
ccccEEEcEEEEEEcccccccccccCEECcccccccccEEEEEEccccEEcccccccEEEEEEEECcccccccccccccCEEEEEccccccEEEEccccccccccEEEEccEEEEEEccHHHHHHHHHHcccccEEEEEcccccccccccccccccCEECccccccccccHHcHHHHHHHcccccccccccccEEECcccccccccccEEEEccEEEEcccccccccccccccccccccccHHHHHHHHHccccccccccccccEEEEEcEEEccccccccccEEEEcccEEEEEEccccccccc
***AAKVKSIFVYPIKSCRGISVCQQAPLTPTGFRWDRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQALKISLSKPRDIADGVSVWEWCGSALAEGAEASNWFTNYLGKPSRLVRYNAESETRPVDPKYAAGEKIMFSDCYPFMLLSQGSLDALNKLLKEPIPINRFRPNILVDGCEPFSEDTWTEVRINKFTFQGVKLCSRCKIPTINQDTGDAGPEPNETLKQIRSDKVL*PGRKQRGKIYFGQNMVCKDNLTEGNGKVLKLGDPVFVLKKV********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAAAKVKSIFVYPIKSCRGISVCQQAPLTPTGFRWDRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQALKISLSKPRDIADGVSVWEWCGSALAEGAEASNWFTNYLGKPSRLVRYNAESETRPVDPKYAAGEKIMFSDCYPFMLLSQGSLDALNKLLKEPIPINRFRPNILVDGCEPFSEDTWTEVRINKFTFQGVKLCSRCKIPTINQDTGDAGPEPNETLKQIRSDKVLRPGRKQRGKIYFGQNMVCKDNLTEGNGKVLKLGDPVFVLKKVTSAAEAAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MOSC domain-containing protein 1, mitochondrial As a component of an N-hydroxylated prodrug-converting complex required to reduce N-hydroxylated prodrugs, such as benzamidoxime. Also able to reduce N(omega)-hydroxy-L-arginine (NOHA) and N(omega)-hydroxy-N(delta)-methyl-L-arginine (NHAM) into L-arginine and N(delta)-methyl-L-arginine, respectively.probableQ5VT66
MOSC domain-containing protein 1, mitochondrial As a component of an N-hydroxylated prodrug-converting complex required to reduce N-hydroxylated prodrugs, such as benzamidoxime. Also able to reduce N(omega)-hydroxy-L-arginine (NOHA) and N(omega)-hydroxy-N(delta)-methyl-L-arginine (NHAM) into L-arginine and N(delta)-methyl-L-arginine, respectively.probableQ58EJ9

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EXN, chain A
Confidence level:very confident
Coverage over the Query: 7-67,80-144
View the alignment between query and template
View the model in PyMOL
Template: 1ORU, chain A
Confidence level:confident
Coverage over the Query: 163-250,264-297
View the alignment between query and template
View the model in PyMOL