Citrus Sinensis ID: 022000


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MKDSGAASDHRAAVEVTKDRNGIEQVVLRNPRGASAKISLHGGQALSWRTERGEELLFTSTKAIFKPPHAVRGGIPICFPQFGNRGSLEQHGFARNRSWVIDDNPPPLKPSDSQGKVYVDLLLKPSEEDLKIWPHSFEFRLRVSLAADGNLALISRIRNINCKPFSFSIAYHTYFAISDISEVRIEGLETLDYLDNLCQRERFTEQGDALTFESEIDRVYLSSSDKIAILDHERKRTFVIHKEGLPDVVVWNPWERKSKSMADFGDEEYRHMLCVDGAAIEKPITLKPGEEWTGRLELSLVHSS
ccccccccccccEEEEEEcccccCEEEEEcccccEEEEEcccCEEEEEEEccccEEEEEcccccccccccccccccCEECccccccccccccCECcccEEEEccccccccccccccEEEEEEccccHHHccccccccEEEEEEEEcccccEEEEEEEEcccccCEEEEEEccEEEEEccccccEEEcccccccccccccccccccccccEEccccccEEEcccccEEEEECcccccEEEEEEcccccEEEEccccccccccccccccccccEEEEEcccccccEEEccccCEEEEEEEEEEEcc
***************VTKDRNGIEQVVLRNPRGASAKISLHGGQALSWRTERGEELLFTSTKAIFKPPHAVRGGIPICFPQFGNRGSLEQHGFARNRSWVIDDNPPPLKPSDSQGKVYVDLLLKPSEEDLKIWPHSFEFRLRVSLAADGNLALISRIRNINCKPFSFSIAYHTYFAISDISEVRIEGLETLDYLDNLCQRERFTEQGDALTFESEIDRVYLSSSDKIAILDHERKRTFVIHKEGLPDVVVWNPWERKSKSMADFGDEEYRHMLCVDGAAIEKPITLKPGEEWTGRLELSLVHS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKDSGAASDHRAAVEVTKDRNGIEQVVLRNPRGASAKISLHGGQALSWRTERGEELLFTSTKAIFKPPHAVRGGIPICFPQFGNRGSLEQHGFARNRSWVIDDNPPPLKPSDSQGKVYVDLLLKPSEEDLKIWPHSFEFRLRVSLAADGNLALISRIRNINCKPFSFSIAYHTYFAISDISEVRIEGLETLDYLDNLCQRERFTEQGDALTFESEIDRVYLSSSDKIAILDHERKRTFVIHKEGLPDVVVWNPWERKSKSMADFGDEEYRHMLCVDGAAIEKPITLKPGEEWTGRLELSLVHSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative glucose-6-phosphate 1-epimerase probableQ40784
Glucose-6-phosphate 1-epimerase Catalyzes the interconversion between the alpha and beta anomers from at least three hexose 6-phosphate sugars (Glc6P, Gal6P, and Man6P).probableQ03161

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HTA, chain A
Confidence level:very confident
Coverage over the Query: 12-301
View the alignment between query and template
View the model in PyMOL