Citrus Sinensis ID: 022045

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300---
MSHRKFEHPRHGSLGFLPRKRASRHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETPPLVVVGVVGYVKTPRGLRSLCTVWAQHLNEEVRRRFYKNWCKSKKKAFTKYTKKYETDDGKKDIQAQLEKMKKYCTVIRKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRSVYLLSSLMGSFSS
cccccccccccccccccccccccccccccccccccccccccCEEEEcccEEccEEEEECccccccccccccCEEEEEEEEcccEEEEEEEEEEEcccccEEEEEEEcccccHHHHHHHHccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccEEEEEEccccccccccccccccccccEEEEEEEECcccccccEEEEccccccccccccccccccccccccccccccccccccccccCEEEEEEEEEEEcccccccccccccccccccccccccccccc
**********HGSLGFLP*K********VKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETPPLVVVGVVGYVKTPRGLRSLCTVWAQHLNEEVRRRFYKNWCKSKKKAFTKYTKKYETDDGKKDIQAQLEKMKKYCTVIRKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKA*******MTEFDRSVYLLSSLMGSF**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHRKFEHPRHGSLGFLPRKRASRHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETPPLVVVGVVGYVKTPRGLRSLCTVWAQHLNEEVRRRFYKNWCKSKKKAFTKYTKKYETDDGKKDIQAQLEKMKKYCTVIRKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRSVYLLSSLMGSFSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L3 The L3 protein is a component of the large subunit of cytoplasmic ribosomes.probableP35684
60S ribosomal protein L3-2 probableP22738
60S ribosomal protein L3 probableQ6FTJ2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain b
Confidence level:very confident
Coverage over the Query: 7-303
View the alignment between query and template
View the model in PyMOL