Citrus Sinensis ID: 022046


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300---
MERPRFVIEAAEAESMAQKSGLTVLQLLPTLVKSAQTLARPPISKFHVGAVGLGSSGRIFLGGNVEFPGLPLHQSIHAEQFLITNLILNAEPRLQHLAVSAAPCGHCRQFLQELRNTSDINICITSINSNERKYHPLSHLLPDRFGPNDLLDKDVPLLLETHQNGMSFNLCNGQIPETENPKERLKYAALEAANKSHAPYSKCPSGVAIMDCEGNIYKGSYMESAAYNPSLGPVQAALVAYLAAGGSGGGGGGYERIVAAALVEKEDAVVRQEHAARLLLQVISPKCEFNVFHCGCKKSCSRF
cccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccCEEEEEEccccEEEEEccccccccccccccHHHHHHHHHHHcccccEEEEEECccccHHHHHHHHHHccccccEEEECccccccCEEECcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccEEEEEEEccccEEEEEEECcccccccccHHHHHHHHHHHccccccccccccEEEEEEEEEcccccccHHHHHHHHHHHHccccEEEEEEcccccccccc
***PRFV*EAAE********GLTVLQLLPTLVKSAQTLARPPISKFHVGAVGLGSSGRIFLGGNVEFPGLPLHQSIHAEQFLITNLILNAEPRLQHLAVSAAPCGHCRQFLQELRNTSDINICITSINSNERKYHPLSHLLPDRFGPNDLLDKDVPLLLETHQNGMSFNLCNGQIPETENPKERLKYAALEAANKSHAPYSKCPSGVAIMDCEGNIYKGSYMESAAYNPSLGPVQAALVAYLAAGGSGGGGGGYERIVAAALVEKEDAVVRQEHAARLLLQVISPKCEFNVFHCGCKK*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERPRFVIEAAEAESMAQKSGLTVLQLLPTLVKSAQTLARPPISKFHVGAVGLGSSGRIFLGGNVEFPGLPLHQSIHAEQFLITNLILNAEPRLQHLAVSAAPCGHCRQFLQELRNTSDINICITSINSNERKYHPLSHLLPDRFGPNDLLDKDVPLLLETHQNGMSFNLCNGQIPETENPKERLKYAALEAANKSHAPYSKCPSGVAIMDCEGNIYKGSYMESAAYNPSLGPVQAALVAYLAAGGSGGGGGGYERIVAAALVEKEDAVVRQEHAARLLLQVISPKCEFNVFHCGCKKSCSRF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytidine deaminase This enzyme scavenge exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis.probableB5FMZ9
Cytidine deaminase This enzyme scavenge exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis.probableB5RC22
Cytidine deaminase This enzyme scavenge exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis.probableQ2NUD2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.5.-.-Acting on carbon-nitrogen bonds, other than peptide bonds.probable
3.5.4.-4'-demethylrebeccamycin synthase.probable
3.5.4.5Cytidine deaminase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D30, chain A
Confidence level:very confident
Coverage over the Query: 22-144
View the alignment between query and template
View the model in PyMOL
Template: 3MPZ, chain A
Confidence level:very confident
Coverage over the Query: 177-296
View the alignment between query and template
View the model in PyMOL
Template: 4EG2, chain A
Confidence level:very confident
Coverage over the Query: 5-293
View the alignment between query and template
View the model in PyMOL