Citrus Sinensis ID: 022051

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300---
MAAKKLSETFSKSLIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHLHLMVFELVKNSLRAVEERYMDSDKVAPPIRIIVADGLEDVTIKVLLLFMICLCISFGIFLFLSAFCC
cccccccHHHHHHHHHHHHHHHccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHccccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccEEEEEEcccccccccccccccccccccc
*************LIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHLHLMVFELVKNSLRAVEERYMDSDKVAPPIRIIVADGLEDVTIKVLLLFMICLCISFGIFLFLSAFCC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKKLSETFSKSLIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHLHLMVFELVKNSLRAVEERYMDSDKVAPPIRIIVADGLEDVTIKVLLLFMICLCISFGIFLFLSAFCC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
[Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial Serine protein kinase that inhibits the mitochondrial pyruvate dehydrogenase (PDH) complex (mtPDC) by phosphorylation of the E1 alpha subunit on Ser residues, thus contributing to the regulation of glucose metabolism.probableQ9SBJ1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BTZ, chain A
Confidence level:very confident
Coverage over the Query: 13-288
View the alignment between query and template
View the model in PyMOL