Citrus Sinensis ID: 022086

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300---
MCRKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRARK
cccccccccEEEEEEEccccccccccccHHHHHHHHHcccccEEEcccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEcccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcccccccHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHc
cccccccccEEEEEEccccccccccccHHHHHHHHHHcccEEEEEcccccccccEEHHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccEEEcHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mcrknnrkclytcavrpaaiygpgeerhlpRIVSLAklglvpfkigepsvktdwiYVDNLVLALILASMgllddipgqkgrpiasgqpyfvsdgfpintfefIGPLlktldydlpkswlavphalFLGKVFSFFYSVLYpwlnrwwlpqplilpaevyKVGVTHYFSLLKakdelcyvpivspregmAATISYWQDrkrksldgptIYAWLFCLIGlpalfataylpdigpvpiLRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLakkvdpanakgWFWQTLALGVFSLRLLLKRARK
mcrknnrkclytcavRPAAiygpgeerhLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRARK
MCRKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRARK
*******KCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLL*****
M******KCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKR****GPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRA**
MCRKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRARK
*****NRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRAR*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCRKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRARK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query303 2.2.26 [Sep-21-2011]
Q8WUS8393 Short-chain dehydrogenase yes no 0.524 0.404 0.523 1e-37
Q4R7R1393 Short-chain dehydrogenase N/A no 0.524 0.404 0.523 2e-37
Q32L94393 Short-chain dehydrogenase yes no 0.524 0.404 0.505 3e-36
A8DZE7387 Short-chain dehydrogenase yes no 0.547 0.428 0.451 1e-35
Q9D665394 Short-chain dehydrogenase yes no 0.551 0.423 0.477 2e-35
Q0IH73386 Short-chain dehydrogenase N/A no 0.534 0.419 0.427 4e-31
A6NKP2422 Putative short-chain dehy no no 0.528 0.379 0.387 1e-24
Q9FX01439 3beta-hydroxysteroid-dehy no no 0.633 0.437 0.316 5e-22
Q67ZE1564 3beta-hydroxysteroid-dehy no no 0.650 0.349 0.304 3e-20
O53454370 3 beta-hydroxysteroid deh yes no 0.574 0.470 0.293 4e-18
>sp|Q8WUS8|D42E1_HUMAN Short-chain dehydrogenase/reductase family 42E member 1 OS=Homo sapiens GN=SDR42E1 PE=2 SV=2 Back     alignment and function desciption
 Score =  157 bits (396), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 107/168 (63%), Gaps = 9/168 (5%)

Query: 10  LYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASM 69
           L TCA+RPA IYGPGE+RHLPRIVS  + GL  F  G+P    ++++VDNLV A ILAS 
Sbjct: 178 LRTCALRPAGIYGPGEQRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASE 237

Query: 70  GLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGK 129
            L  D    KG  IASGQPYF+SDG P+N FEF  PL++ L Y  P + L     L L  
Sbjct: 238 ALRAD----KGH-IASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRL----PLTLVY 288

Query: 130 VFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCY 177
            F+F   +++  L R +  QP +   EVYK GVTHYFSL KAK EL Y
Sbjct: 289 CFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGY 336

Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q4R7R1|D42E1_MACFA Short-chain dehydrogenase/reductase family 42E member 1 OS=Macaca fascicularis GN=SDR42E1 PE=2 SV=1 Back     alignment and function description
>sp|Q32L94|D42E1_BOVIN Short-chain dehydrogenase/reductase family 42E member 1 OS=Bos taurus GN=SDR42E1 PE=2 SV=2 Back     alignment and function description
>sp|A8DZE7|D42E1_DANRE Short-chain dehydrogenase/reductase family 42E member 1 OS=Danio rerio GN=sdr42e1 PE=2 SV=1 Back     alignment and function description
>sp|Q9D665|D42E1_MOUSE Short-chain dehydrogenase/reductase family 42E member 1 OS=Mus musculus GN=Sdr42e1 PE=2 SV=1 Back     alignment and function description
>sp|Q0IH73|D42E1_XENLA Short-chain dehydrogenase/reductase family 42E member 1 OS=Xenopus laevis GN=sdr42e1 PE=2 SV=1 Back     alignment and function description
>sp|A6NKP2|D42E2_HUMAN Putative short-chain dehydrogenase/reductase family 42E member 2 OS=Homo sapiens GN=SDR42E2 PE=3 SV=3 Back     alignment and function description
>sp|Q9FX01|HSDD1_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 OS=Arabidopsis thaliana GN=3BETAHSD/D1 PE=2 SV=1 Back     alignment and function description
>sp|Q67ZE1|HSDD2_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2 OS=Arabidopsis thaliana GN=3BETAHSD/D2 PE=2 SV=2 Back     alignment and function description
>sp|O53454|3BHS_MYCTU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis GN=Rv1106c PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query303
255539320 478 hydroxysteroid dehydrogenase, putative [ 0.993 0.629 0.740 1e-134
418729183 478 3-beta-hydroxy-delta5-steroid dehydrogen 0.990 0.627 0.743 1e-133
225457644 478 PREDICTED: short-chain dehydrogenase/red 0.993 0.629 0.704 1e-127
15226138 480 Rossmann-fold NAD(P)-binding domain-cont 0.990 0.625 0.703 1e-124
297745599 479 unnamed protein product [Vitis vinifera] 0.966 0.611 0.699 1e-124
449455641 478 PREDICTED: short-chain dehydrogenase/red 0.993 0.629 0.677 1e-123
297826819 480 3-beta hydroxysteroid dehydrogenase/isom 0.986 0.622 0.695 1e-121
356564410 491 PREDICTED: short-chain dehydrogenase/red 0.980 0.604 0.682 1e-120
388497514 479 unknown [Lotus japonicus] 0.993 0.628 0.672 1e-120
356553309 478 PREDICTED: short-chain dehydrogenase/red 0.993 0.629 0.667 1e-120
>gi|255539320|ref|XP_002510725.1| hydroxysteroid dehydrogenase, putative [Ricinus communis] gi|223551426|gb|EEF52912.1| hydroxysteroid dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 223/301 (74%), Positives = 262/301 (87%)

Query: 3   RKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVL 62
           +KNN K LYTCA+RPAAIYGPGEERH+PRIVS AKLGL+PF+IG+ +VKTDW+YVDNLVL
Sbjct: 178 KKNNGKRLYTCAIRPAAIYGPGEERHMPRIVSYAKLGLMPFRIGDANVKTDWVYVDNLVL 237

Query: 63  ALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVP 122
           ALILASMGLLDDIP   G P+A+GQPYF+SDG PIN+FEF+ PLLK+L+YD+PK+ L+VP
Sbjct: 238 ALILASMGLLDDIPNSGGHPVAAGQPYFISDGSPINSFEFLQPLLKSLNYDMPKASLSVP 297

Query: 123 HALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVS 182
           HAL LGK+F   Y++LYPWLNRWWLPQP ILPAEVYKVGVTHYFS LKAK+EL YVP+V+
Sbjct: 298 HALILGKIFGAIYTLLYPWLNRWWLPQPFILPAEVYKVGVTHYFSFLKAKEELGYVPMVT 357

Query: 183 PREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFI 242
           PREGMAATI+YWQ++KRKSLDGPTIY WLF +IG+  LF  AYLPDIGPVP+ R I LF 
Sbjct: 358 PREGMAATIAYWQEKKRKSLDGPTIYIWLFAVIGMSTLFCAAYLPDIGPVPLFRAISLFF 417

Query: 243 FKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRAR 302
            +SM M R  F +A +AH+ E ++AW LAK+VDPANA+GWFWQTLALG+FSLR LLKRAR
Sbjct: 418 LRSMRMTRTVFLLASAAHIGESIYAWHLAKRVDPANARGWFWQTLALGIFSLRFLLKRAR 477

Query: 303 K 303
           K
Sbjct: 478 K 478

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|418729183|gb|AFX66971.1| 3-beta-hydroxy-delta5-steroid dehydrogenase [Solanum tuberosum] Back     alignment and taxonomy information
>gi|225457644|ref|XP_002275214.1| PREDICTED: short-chain dehydrogenase/reductase family 42E member 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15226138|ref|NP_180921.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] gi|16226673|gb|AAL16229.1|AF428460_1 At2g33630/F4P9.40 [Arabidopsis thaliana] gi|2459443|gb|AAB80678.1| putative steroid dehydrogenase [Arabidopsis thaliana] gi|20260208|gb|AAM13002.1| putative steroid dehydrogenase [Arabidopsis thaliana] gi|330253770|gb|AEC08864.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297745599|emb|CBI40764.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449455641|ref|XP_004145560.1| PREDICTED: short-chain dehydrogenase/reductase family 42E member 1-like [Cucumis sativus] gi|449522962|ref|XP_004168494.1| PREDICTED: short-chain dehydrogenase/reductase family 42E member 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297826819|ref|XP_002881292.1| 3-beta hydroxysteroid dehydrogenase/isomerase family protein [Arabidopsis lyrata subsp. lyrata] gi|297327131|gb|EFH57551.1| 3-beta hydroxysteroid dehydrogenase/isomerase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356564410|ref|XP_003550447.1| PREDICTED: short-chain dehydrogenase/reductase family 42E member 1-like [Glycine max] Back     alignment and taxonomy information
>gi|388497514|gb|AFK36823.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356553309|ref|XP_003544999.1| PREDICTED: short-chain dehydrogenase/reductase family 42E member 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query303
TAIR|locus:2051063480 AT2G33630 [Arabidopsis thalian 0.990 0.625 0.703 9.8e-119
UNIPROTKB|I3L900390 SDR42E1 "Uncharacterized prote 0.524 0.407 0.517 9.2e-36
UNIPROTKB|Q8WUS8393 SDR42E1 "Short-chain dehydroge 0.686 0.529 0.447 1.2e-35
UNIPROTKB|J9NYA9393 SDR42E1 "Uncharacterized prote 0.524 0.404 0.523 1.5e-35
UNIPROTKB|F1MDX4398 SDR42E1 "Short-chain dehydroge 0.524 0.399 0.505 2.8e-34
UNIPROTKB|G3X7Y2393 SDR42E1 "Short-chain dehydroge 0.524 0.404 0.505 2.8e-34
UNIPROTKB|Q32L94393 SDR42E1 "Short-chain dehydroge 0.524 0.404 0.505 2.8e-34
ZFIN|ZDB-GENE-051120-63400 sdr42e1 "short chain dehydroge 0.702 0.532 0.391 2e-33
MGI|MGI:1921282394 Sdr42e1 "short chain dehydroge 0.531 0.408 0.488 2.5e-33
UNIPROTKB|E1C6D8391 SDR42E1 "Uncharacterized prote 0.547 0.424 0.462 4.1e-33
TAIR|locus:2051063 AT2G33630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1169 (416.6 bits), Expect = 9.8e-119, P = 9.8e-119
 Identities = 211/300 (70%), Positives = 257/300 (85%)

Query:     4 KNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLA 63
             KN  K +YTCA+RPAAIYGPGE+RHLPRIV+L KLGL  FKIGEPSVK+DWIYV+NLVLA
Sbjct:   178 KNGGKRMYTCAIRPAAIYGPGEDRHLPRIVTLTKLGLALFKIGEPSVKSDWIYVENLVLA 237

Query:    64 LILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPH 123
             +ILASMGLLDDIPG++G+P+A+GQPYFVSDG+P+NTFEF+ PLLK+LDYDLPK  ++VP 
Sbjct:   238 IILASMGLLDDIPGREGQPVAAGQPYFVSDGYPVNTFEFLRPLLKSLDYDLPKCTISVPF 297

Query:   124 ALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSP 183
             AL LGK+F  FY+VLYPWL++ WLPQPL+LPAEVYKVGVTHYFS LKAK+EL YVP  S 
Sbjct:   298 ALSLGKIFQGFYTVLYPWLSKSWLPQPLVLPAEVYKVGVTHYFSYLKAKEELGYVPFKSS 357

Query:   184 REGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIF 243
             +EGMAATISYWQ+RKR+SLDGPT++ W+   IG+ ALFA  +LPDIGPVP LR I LF F
Sbjct:   358 KEGMAATISYWQERKRRSLDGPTMFTWIAVTIGMSALFAAGWLPDIGPVPFLRAIHLFFF 417

Query:   244 KSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRARK 303
             +++ +++  F +AV  HV+EG++AW LAK+VDP NA GWF QT ALG FS+R LLKRA++
Sbjct:   418 RTITIVKAVFIVAVVLHVAEGIYAWFLAKRVDPGNAMGWFLQTSALGFFSMRFLLKRAKE 477
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003854 "3-beta-hydroxy-delta5-steroid dehydrogenase activity" evidence=IEA;ISS
GO:0006694 "steroid biosynthetic process" evidence=IEA;ISS
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IDA
UNIPROTKB|I3L900 SDR42E1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WUS8 SDR42E1 "Short-chain dehydrogenase/reductase family 42E member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYA9 SDR42E1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MDX4 SDR42E1 "Short-chain dehydrogenase/reductase family 42E member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3X7Y2 SDR42E1 "Short-chain dehydrogenase/reductase family 42E member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q32L94 SDR42E1 "Short-chain dehydrogenase/reductase family 42E member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051120-63 sdr42e1 "short chain dehydrogenase/reductase family 42E, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1921282 Sdr42e1 "short chain dehydrogenase/reductase family 42E, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6D8 SDR42E1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00002931001
SubName- Full=Chromosome chr18 scaffold_137, whole genome shotgun sequence; (478 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
cd09812339 cd09812, 3b-HSD_like_1_SDR_e, 3beta-hydroxysteroid 2e-49
cd05241331 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid d 5e-37
pfam01073280 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydr 2e-33
cd09813335 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD 2e-29
cd09811354 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD 1e-13
cd05232303 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, 2e-06
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 4e-06
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 5e-04
cd05266251 cd05266, SDR_a4, atypical (a) SDRs, subgroup 4 0.004
>gnl|CDD|187672 cd09812, 3b-HSD_like_1_SDR_e, 3beta-hydroxysteroid dehydrogenase (3b-HSD)-like, subgroup1, extended (e) SDRs Back     alignment and domain information 
 Score =  167 bits (424), Expect = 2e-49
 Identities = 86/176 (48%), Positives = 108/176 (61%), Gaps = 9/176 (5%)

Query: 4   KNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLA 63
            NN   L TCA+RPA IYGPGE+RHLPRIVS  + GL  F  G+P    ++++VDNLV A
Sbjct: 161 PNNGGVLRTCALRPAGIYGPGEQRHLPRIVSYIEKGLFMFVYGDPKSLVEFVHVDNLVQA 220

Query: 64  LILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPH 123
            ILA+  L       KG  IASGQ YF+SDG P+N FEF  PL++ L Y  P   L +P 
Sbjct: 221 HILAAEALTTA----KGY-IASGQAYFISDGRPVNNFEFFRPLVEGLGYSFP--SLRLPL 273

Query: 124 ALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVP 179
           +L     F+F   +++  L      QPL+   EVYK GVTHYFS+ KA+ EL Y P
Sbjct: 274 SLVY--FFAFLTEMVHFALGPICNFQPLLTRTEVYKTGVTHYFSIEKARAELGYEP 327

An uncharacterized subgroup of the 3b-HSD-like extended-SDR family. Proteins in this subgroup have the characteristic active site tetrad and NAD(P)-binding motif of extended-SDRs. 3 beta-HSD catalyzes the oxidative conversion of delta 5-3 beta-hydroxysteroids to the delta 4-3-keto configuration; this activity is essential for the biosynthesis of all classes of hormonal steroids. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid sythase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 339
>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>gnl|CDD|187673 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD(P)H steroid dehydrogenase-like protein)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187671 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD (hydroxysteroid dehydrogenase) and HSD3B1(delta 5-delta 4-isomerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|187576 cd05266, SDR_a4, atypical (a) SDRs, subgroup 4 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 303
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 99.97
PF1493491 DUF4499: Domain of unknown function (DUF4499) 99.94
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.81
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.79
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.78
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.77
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.76
PLN00016378 RNA-binding protein; Provisional 99.75
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 99.74
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.74
PLN02166436 dTDP-glucose 4,6-dehydratase 99.73
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.73
PLN02427386 UDP-apiose/xylose synthase 99.73
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.72
PLN02206442 UDP-glucuronate decarboxylase 99.72
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.71
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.7
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.68
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.68
PLN02240352 UDP-glucose 4-epimerase 99.67
PLN02260 668 probable rhamnose biosynthetic enzyme 99.67
PLN02572442 UDP-sulfoquinovose synthase 99.66
PLN02653340 GDP-mannose 4,6-dehydratase 99.66
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.66
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.65
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.64
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.64
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.62
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.6
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 99.6
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.59
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.59
PLN02214342 cinnamoyl-CoA reductase 99.58
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.55
PLN00198338 anthocyanidin reductase; Provisional 99.55
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.54
PRK05865 854 hypothetical protein; Provisional 99.52
PLN02650351 dihydroflavonol-4-reductase 99.47
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.47
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.47
PLN02896353 cinnamyl-alcohol dehydrogenase 99.47
PRK07201 657 short chain dehydrogenase; Provisional 99.47
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.45
CHL00194317 ycf39 Ycf39; Provisional 99.44
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.31
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 99.31
PLN02686367 cinnamoyl-CoA reductase 99.27
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.23
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.12
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.09
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.07
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.06
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.03
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 98.95
PLN02996491 fatty acyl-CoA reductase 98.94
TIGR01746367 Thioester-redct thioester reductase domain. It has 98.87
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 98.87
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.87
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 98.81
PLN02583297 cinnamoyl-CoA reductase 98.67
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 98.62
PLN02503605 fatty acyl-CoA reductase 2 98.48
PRK12320 699 hypothetical protein; Provisional 98.47
PLN02778298 3,5-epimerase/4-reductase 98.42
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 98.42
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.14
PF1395062 Epimerase_Csub: UDP-glucose 4-epimerase C-term sub 98.08
PLN02260668 probable rhamnose biosynthetic enzyme 97.46
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 96.64
PRK09135249 pteridine reductase; Provisional 96.49
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 96.13
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 96.09
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 96.01
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 95.69
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 95.57
PRK07074257 short chain dehydrogenase; Provisional 95.57
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 95.36
PRK06482276 short chain dehydrogenase; Provisional 94.96
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.87
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 94.81
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 94.56
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 94.39
PRK07067257 sorbitol dehydrogenase; Provisional 94.3
PRK12829264 short chain dehydrogenase; Provisional 94.1
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 93.92
PRK05875276 short chain dehydrogenase; Provisional 93.23
PRK08324681 short chain dehydrogenase; Validated 92.78
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.6
PRK06123248 short chain dehydrogenase; Provisional 92.23
PRK12935247 acetoacetyl-CoA reductase; Provisional 91.91
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.84
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 91.14
PRK05876275 short chain dehydrogenase; Provisional 90.95
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.45
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 90.39
PRK08263275 short chain dehydrogenase; Provisional 90.06
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.01
PRK07806248 short chain dehydrogenase; Provisional 88.94
KOG2774366 consensus NAD dependent epimerase [General functio 88.47
PRK07775274 short chain dehydrogenase; Provisional 86.57
PRK06914280 short chain dehydrogenase; Provisional 86.49
PRK12828239 short chain dehydrogenase; Provisional 85.23
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 84.9
PRK07523255 gluconate 5-dehydrogenase; Provisional 84.47
PRK07774250 short chain dehydrogenase; Provisional 84.09
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.71
PRK07890258 short chain dehydrogenase; Provisional 81.84
KOG4288283 consensus Predicted oxidoreductase [General functi 81.13
PRK07060245 short chain dehydrogenase; Provisional 80.51
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information 
Probab=99.97  E-value=9.9e-30  Score=239.37  Aligned_cols=186  Identities=41%  Similarity=0.665  Sum_probs=174.1

Q ss_pred             ccCC-CCCceEEEEecCCcccCCCCCCHHHHHHHHHcCCCCeeeCCCCcccccccHHHHHHHHHHHHhcccCCCCCCCCC
Q 022086            3 RKNN-RKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGR   81 (303)
Q Consensus         3 ~~~~-~~~l~t~iLRP~~IYGpg~~~~l~~iv~~~~~g~~~~~~g~g~~~~~~VhV~Dla~A~ilA~~~L~~~~~~~~~~   81 (303)
                      +++| +++|.||+|||+.||||||+.+.+.++..+++|..++..|+++...|++|++|++.||++|..+|.+.      .
T Consensus       165 l~an~~~~l~T~aLR~~~IYGpgd~~~~~~i~~~~~~g~~~f~~g~~~~~~~~~~~~Nva~ahilA~~aL~~~------~  238 (361)
T KOG1430|consen  165 LEANGSDDLYTCALRPPGIYGPGDKRLLPKIVEALKNGGFLFKIGDGENLNDFTYGENVAWAHILAARALLDK------S  238 (361)
T ss_pred             HHhcCCCCeeEEEEccccccCCCCccccHHHHHHHHccCceEEeeccccccceEEechhHHHHHHHHHHHHhc------C
Confidence            3444 68899999999999999999999999999999999999999999999999999999999999999864      6


Q ss_pred             CCCCCCcEEecCCCCcCHHHHHHHHHHhcCCCCC-ccccCHHHHHHHHHHHHHHHhhhhhhcccccCCCCCCCHHHHHhh
Q 022086           82 PIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLP-KSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKV  160 (303)
Q Consensus        82 ~~a~G~~ynI~dg~pvs~~e~~~~l~e~lg~~~p-~~~lP~~~~~~~a~~~e~~~~ll~p~~~~~~~~~p~lt~~~v~~~  160 (303)
                      +..+||.|||+|++|+..++++.++.+.+|+..| .+.+|.++.+.++.+.|+++++++|       .+|.+++.+++..
T Consensus       239 ~~~~Gq~yfI~d~~p~~~~~~~~~l~~~lg~~~~~~~~~p~~l~~~~~~l~e~~~~~l~p-------~~p~lt~~~v~~~  311 (361)
T KOG1430|consen  239 PSVNGQFYFITDDTPVRFFDFLSPLVKALGYCLPSSIKLPLFLSYFLAYLLEIVYFLLRP-------YQPILTRFRVALL  311 (361)
T ss_pred             CccCceEEEEeCCCcchhhHHHHHHHHhcCCCCCceeecchHHHHHHHHHHHHHHHhccC-------CCCCcChhheeee
Confidence            7899999999999999999999999999999998 7889999999999999999999987       4899999999999


Q ss_pred             hcccccChHhHHHhCCCCcCCChHHHHHHHHHHHHHccCCC
Q 022086          161 GVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKS  201 (303)
Q Consensus       161 ~~~~~~d~~Ka~~eLG~~P~~s~~e~l~~tv~~~~~~~~~~  201 (303)
                      +.+++||++||+++|||+|..+++|++.+++.|+.......
T Consensus       312 ~~~~~f~~~kA~~~lgY~P~~~~~e~~~~~~~~~~~~~~~~  352 (361)
T KOG1430|consen  312 GVTRTFSIEKAKRELGYKPLVSLEEAIQRTIHWVASESDSA  352 (361)
T ss_pred             ccccccCHHHHHHhhCCCCcCCHHHHHHHHHHHHhhhhhcc
Confidence            99999999999999999999999999999999987765543

>PF14934 DUF4499: Domain of unknown function (DUF4499) Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 3e-20
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 7e-04
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
 Score = 88.5 bits (220), Expect = 3e-20
 Identities = 25/187 (13%), Positives = 62/187 (33%), Gaps = 26/187 (13%)

Query: 12  TCAVRPAAIYGPGEERHLP-RIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMG 70
                P  + G  +      R+++    G +   +     + + I        L++A   
Sbjct: 176 VVIGIPGMVLGELDIGPTTGRVITAIGNGEMTHYVA---GQRNVIDAAEAGRGLLMA--- 229

Query: 71  LLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKV 130
                  ++GR    G+ Y ++ G  +   +    + + L    P+    +  A+     
Sbjct: 230 ------LERGRI---GERYLLT-GHNLEMADLTRRIAELLGQPAPQP---MSMAMA---- 272

Query: 131 FSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAAT 190
                + L     R     PL+    +  +    +    KA++EL +    +  + +   
Sbjct: 273 --RALATLGRLRYRVSGQLPLLDETAIEVMAGGQFLDGRKAREELGFFSTTALDDTLLRA 330

Query: 191 ISYWQDR 197
           I +++D 
Sbjct: 331 IDWFRDN 337
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query303
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.8
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.79
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.79
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.79
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.79
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.78
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.77
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.77
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.77
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.76
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.76
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.75
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.75
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.75
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.74
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.74
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.74
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.74
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.74
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.73
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.73
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.72
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.72
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.72
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.71
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.71
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.71
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.71
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.71
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.7
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.7
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.7
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.7
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.7
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.69
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.68
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.68
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.66
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.65
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.64
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.63
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.63
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.63
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.63
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.62
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.61
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.6
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.6
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.59
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.59
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.56
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.55
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.48
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.48
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.46
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.45
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.44
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.41
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.41
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.39
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.29
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.24
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.21
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.09
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.04
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 98.97
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.89
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 98.6
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 98.57
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 98.56
2wm3_A299 NMRA-like family domain containing protein 1; unkn 98.49
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.44
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 98.4
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 98.31
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 98.27
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 98.14
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.1
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 98.08
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 98.07
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 98.02
1xq6_A253 Unknown protein; structural genomics, protein stru 97.98
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 97.9
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.89
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 97.73
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 97.02
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 96.91
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.7
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.48
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.87
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 95.8
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 95.66
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 95.54
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 95.01
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 94.87
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 94.82
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 94.52
1spx_A278 Short-chain reductase family member (5L265); paral 94.47
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 94.42
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 94.15
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 93.48
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 93.39
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 93.25
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 93.09
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 93.04
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 92.94
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 92.83
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 92.29
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 92.15
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 91.99
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 91.88
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 91.74
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 91.49
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 91.47
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 91.43
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 91.33
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 91.27
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 90.73
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 90.52
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 90.25
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 90.04
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 89.89
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 89.74
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 89.72
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 89.5
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 89.42
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 89.36
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 88.73
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 88.67
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 88.58
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 88.44
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 88.42
1xq1_A266 Putative tropinone reducatse; structural genomics, 88.19
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 88.19
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 88.13
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 88.05
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 87.98
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 87.89
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 87.38
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 86.76
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 86.74
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 86.64
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 86.17
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 86.11
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 85.95
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 85.88
3qlj_A322 Short chain dehydrogenase; structural genomics, se 85.71
3rih_A293 Short chain dehydrogenase or reductase; structural 85.66
3gem_A260 Short chain dehydrogenase; structural genomics, AP 85.45
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 85.43
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 85.1
3imf_A257 Short chain dehydrogenase; structural genomics, in 84.64
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 84.49
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 84.22
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 84.19
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 84.06
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 83.95
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 82.48
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 82.16
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 81.89
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 81.89
3tox_A280 Short chain dehydrogenase; structural genomics, PS 81.84
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 81.81
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 81.69
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 81.58
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 81.22
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 80.94
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 80.43
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
Probab=99.80  E-value=2.7e-19  Score=162.60  Aligned_cols=148  Identities=14%  Similarity=0.138  Sum_probs=119.5

Q ss_pred             CCceEEEEecCCcccCCCC------CCHHHHHHH----HHcCCCCeeeCCCCcccccccHHHHHHHHHHHHhcccCCCCC
Q 022086            8 KCLYTCAVRPAAIYGPGEE------RHLPRIVSL----AKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPG   77 (303)
Q Consensus         8 ~~l~t~iLRP~~IYGpg~~------~~l~~iv~~----~~~g~~~~~~g~g~~~~~~VhV~Dla~A~ilA~~~L~~~~~~   77 (303)
                      .+++++++||+.+|||++.      ..++.+++.    +..|..+..+|++++.++|+||+|+|++++.+++.       
T Consensus       160 ~~~~~~ilRp~~v~Gp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~i~v~Dva~a~~~~~~~-------  232 (319)
T 4b8w_A          160 YGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLRE-------  232 (319)
T ss_dssp             HCCEEEEEEECEEECTTCCCCTTTSCHHHHHHHHHHHHHHHTCCEEEESCSCCEECEEEHHHHHHHHHHHHHH-------
T ss_pred             hCCCEEEEeeccccCCCCCCCCccccccHHHHHHHHHHhccCCceEEeCCCCeeEEEEeHHHHHHHHHHHHhc-------
Confidence            4689999999999999864      345666665    78888777889999999999999999999999984       


Q ss_pred             CCCCCCCCCCcEEecCCCCcCHHHHHHHHHHhcCCCCCccccCHHHHHHHHHHHHHHHhhhhhhcccccCCCCCCCHHHH
Q 022086           78 QKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEV  157 (303)
Q Consensus        78 ~~~~~~a~G~~ynI~dg~pvs~~e~~~~l~e~lg~~~p~~~lP~~~~~~~a~~~e~~~~ll~p~~~~~~~~~p~lt~~~v  157 (303)
                         .+...+++||+++++++++.|+++.+.+.+|.+.+....|.                           .+.      
T Consensus       233 ---~~~~~~~~~ni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~---------------------------~~~------  276 (319)
T 4b8w_A          233 ---YNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTT---------------------------KSD------  276 (319)
T ss_dssp             ---CCCSSCEEECCCGGGCEEHHHHHHHHHHHTTCCSCEEEETT---------------------------SCC------
T ss_pred             ---cccCCceEEEecCCCceeHHHHHHHHHHHhCCCCcEEeCCC---------------------------CCc------
Confidence               23345779999999999999999999999997755432221                           010      


Q ss_pred             HhhhcccccChHhHHHhCCCCcCCChHHHHHHHHHHHHHccCC
Q 022086          158 YKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRK  200 (303)
Q Consensus       158 ~~~~~~~~~d~~Ka~~eLG~~P~~s~~e~l~~tv~~~~~~~~~  200 (303)
                        ......+|++|++++|||+|.++++++++++++||+++..+
T Consensus       277 --~~~~~~~d~~k~~~~lg~~p~~~~~~~l~~~~~~~~~~~~~  317 (319)
T 4b8w_A          277 --GQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQ  317 (319)
T ss_dssp             --CCSCCCBCCHHHHHHCTTCCCCCHHHHHHHHHHHHHHSCSS
T ss_pred             --CcccccCCHHHHHHhcCCCCCCCHHHHHHHHHHHHHHHHhh
Confidence              01234689999999999999999999999999999987643
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 303
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 1e-07
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 2e-07
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 1e-06
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 6e-05
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 0.002
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptococcus suis, serotype 2 [TaxId: 1307]

 Score = 50.1 bits (119), Expect = 1e-07
 Identities = 29/192 (15%), Positives = 55/192 (28%), Gaps = 43/192 (22%)

Query: 10  LYTCAVRPAAIYGPGE--ERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILA 67
           L T     +  YGP    E+ +P ++  A  G      G+     DW+YV++   AL + 
Sbjct: 187 LPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHARALHMV 246

Query: 68  SMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFL 127
                      +G+    G+ Y +         +                          
Sbjct: 247 V---------TEGKA---GETYNIGGHNEKKNLD-------------------------- 268

Query: 128 GKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYF-SLLKAKDELCYVPIVSPREG 186
             V      +L   + +    +  I            Y     K   EL + P+ +   G
Sbjct: 269 --VVFTICDLLDEIVPKATSYREQITYVADRPGHDRRYAIDAGKISRELGWKPLETFESG 326

Query: 187 MAATISYWQDRK 198
           +  T+ ++    
Sbjct: 327 IRKTVEWYLANT 338
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query303
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.84
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.8
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.78
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.76
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.76
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.75
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.74
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.71
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.71
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.69
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.69
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.66
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.66
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.62
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.59
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.59
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.58
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.57
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.56
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.55
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.53
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.22
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 98.92
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.9
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.8
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.02
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 96.87
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 96.69
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 96.64
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.8
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptomyces venezuelae [TaxId: 54571]

Probab=99.84  E-value=3.5e-21  Score=175.68  Aligned_cols=145  Identities=22%  Similarity=0.301  Sum_probs=120.6

Q ss_pred             CCceEEEEecCCcccCCCC--CCHHHHHHHHHcCCCCeeeCCCCcccccccHHHHHHHHHHHHhcccCCCCCCCCCCCCC
Q 022086            8 KCLYTCAVRPAAIYGPGEE--RHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIAS   85 (303)
Q Consensus         8 ~~l~t~iLRP~~IYGpg~~--~~l~~iv~~~~~g~~~~~~g~g~~~~~~VhV~Dla~A~ilA~~~L~~~~~~~~~~~~a~   85 (303)
                      .+++++++||+.||||++.  +.++.+++.+.+|..+.++|+|++.+||+||+|+|+++..+++.            ...
T Consensus       169 ~~~~~~~lR~~~vyGp~~~~~~~i~~~i~~~~~~~~i~v~~~g~~~r~~i~v~D~a~ai~~~~~~------------~~~  236 (322)
T d1r6da_         169 YGLDVRITRCCNNYGPYQHPEKLIPLFVTNLLDGGTLPLYGDGANVREWVHTDDHCRGIALVLAG------------GRA  236 (322)
T ss_dssp             HCCCEEEEEECEEECTTCCTTSHHHHHHHHHHTTCCEEEETTSCCEEEEEEHHHHHHHHHHHHHH------------CCT
T ss_pred             hCCCEEEEEeeeEECcCCCcCcHHHHHHHHHHcCCCcEEecCCCeEEccEEHHHHHHHHHHHHhC------------CCC
Confidence            4789999999999999874  57899999999999878889999999999999999999999984            234


Q ss_pred             CCcEEecCCCCcCHHHHHHHHHHhcCCCCCccccCHHHHHHHHHHHHHHHhhhhhhcccccCCCCCCCHHHHHhhhcccc
Q 022086           86 GQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHY  165 (303)
Q Consensus        86 G~~ynI~dg~pvs~~e~~~~l~e~lg~~~p~~~lP~~~~~~~a~~~e~~~~ll~p~~~~~~~~~p~lt~~~v~~~~~~~~  165 (303)
                      |++||+++++++++.|+++.+.+.+|.+.+.+...                      .    ..+.        -.....
T Consensus       237 ~~~~ni~~~~~~s~~e~~~~i~~~~~~~~~~~~~~----------------------~----~~~~--------~~~~~~  282 (322)
T d1r6da_         237 GEIYHIGGGLELTNRELTGILLDSLGADWSSVRKV----------------------A----DRKG--------HDLRYS  282 (322)
T ss_dssp             TCEEEECCCCEEEHHHHHHHHHHHHTCCGGGEEEE----------------------C----CCTT--------CCCBCC
T ss_pred             CCeeEEeecccchhHHHHHHHHHHhCCCccceeec----------------------C----CCCC--------CCceee
Confidence            78999999999999999999999999764432100                      0    1111        012345


Q ss_pred             cChHhHHHhCCCCcCCChHHHHHHHHHHHHHcc
Q 022086          166 FSLLKAKDELCYVPIVSPREGMAATISYWQDRK  198 (303)
Q Consensus       166 ~d~~Ka~~eLG~~P~~s~~e~l~~tv~~~~~~~  198 (303)
                      .|++|++++|||+|+++++|+++++++||++++
T Consensus       283 ~d~~k~~~~lg~~p~~~~eegI~~~i~w~~~n~  315 (322)
T d1r6da_         283 LDGGKIERELGYRPQVSFADGLARTVRWYRENR  315 (322)
T ss_dssp             BCCHHHHHHHCCCCCSCHHHHHHHHHHHHHHCH
T ss_pred             eCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHhH
Confidence            799999999999999999999999999999865
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure