Citrus Sinensis ID: 022103


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MKSQEPDPNYFSSSSSSSSLVSSTKWWSKETIAIVTGANKGIGFALVKRLAELGLTVILTARDVERGQRAVESLSEKGLPVNFFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAKLLTESLLPLFRRSPSKSRILNISSRLGTLSKVRNPNIKSILEDEELSEEQIERFVGLFLQSVKDGTWKSQGWPEIWTDYAVSKLALNAYTMVLAKRYEGEGISVNSYCPGFTQTSMTQGQGSHTADEAADVGARLLLLHPQQLPTAKFYIGLDPFVKSNL
cccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHcccccEEEEcccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHcccccccEEEEccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEECccccccccccccccccHHHHHHHHHHHHcccccccccccEEccccccccccc
************************KWWSKETIAIVTGANKGIGFALVKRLAELGLTVILTARDVERGQRAVESLSEKGLPVNFFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAKLLTESLLPLFRRSPSKSRILNISSRLGTLSKVRNPNIKSILEDEELSEEQIERFVGLFLQSVKDGTWKSQGWPEIWTDYAVSKLALNAYTMVLAKRYEGEGISVNSYCPGFTQTSMTQGQGSHTADEAADVGARLLLLHPQQLPTAKFYIGLDPFVKS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSQEPDPNYFSSSSSSSSLVSSTKWWSKETIAIVTGANKGIGFALVKRLAELGLTVILTARDVERGQRAVESLSEKGLPVNFFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAKLLTESLLPLFRRSPSKSRILNISSRLGTLSKVRNPNIKSILEDEELSEEQIERFVGLFLQSVKDGTWKSQGWPEIWTDYAVSKLALNAYTMVLAKRYEGEGISVNSYCPGFTQTSMTQGQGSHTADEAADVGARLLLLHPQQLPTAKFYIGLDPFVKSNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Carbonyl reductase [NADPH] 1 NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.probableP16152
Carbonyl reductase [NADPH] 1 NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.probableP48758
Carbonyl reductase [NADPH] 1 NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.probableQ5RCU5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ET6, chain A
Confidence level:very confident
Coverage over the Query: 26-175,218-297
View the alignment between query and template
View the model in PyMOL
Template: 3O26, chain A
Confidence level:very confident
Coverage over the Query: 30-293
View the alignment between query and template
View the model in PyMOL
Template: 3R1I, chain A
Confidence level:very confident
Coverage over the Query: 21-174,215-298
View the alignment between query and template
View the model in PyMOL