Citrus Sinensis ID: 022111


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MPAQKIETGHEDTVHDVAMDFYGKRLATASSDSSIKIIGLSNSASQHLATLKGHRGPVWQVAWAHPKFGSILASCSYDGQVIIWKEGNQNDWTQAHTFNDHKSSVNSIAWAPHELGLSLACGSSDGNISVFTATADGGWDTTRIDQAHPVGVTSVSWAPAMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANNVTLWKEAVDGEWQQVSVVEPQT
cccccccccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEEEECcccccEEEEEECccccccEEEEccccccEEEEEcccccccCEEEEcccccccEEEEEEcccccccEEEEECccccEEEEEccccccCEEEEEcccccccEEEEEEcccccccccccccccccccEEEEECccccEEEEEcccccCEEEEccccccccccEEEEEEcccccccccEEEEECccccEEEEEcccccCEEcccccccccccEEEEEEcccccEEEEEccccEEEEEcccccCEEEEEECcccc
*PAQKIETGHEDTVHDVAMDFYGKRLATASSDSSIKIIGLSNSASQHLATLKGHRGPVWQVAWAHPKFGSILASCSYDGQVIIWKEGNQNDWTQAHTFNDHKSSVNSIAWAPHELGLSLACGSSDGNISVFTATADGGWDTTRIDQAHPVGVTSVSWAPAMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANNVTLWKEAVDGEWQQVSVVEP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAQKIETGHEDTVHDVAMDFYGKRLATASSDSSIKIIGLSNSASQHLATLKGHRGPVWQVAWAHPKFGSILASCSYDGQVIIWKEGNQNDWTQAHTFNDHKSSVNSIAWAPHELGLSLACGSSDGNISVFTATADGGWDTTRIDQAHPVGVTSVSWAPAMAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANNVTLWKEAVDGEWQQVSVVEPQT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein SEC13 homolog Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles.probableQ5XFW8
Protein SEC13 homolog Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles.probableQ9D1M0
Protein transport protein SEC13 Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. It also functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. SEC13 is required for efficient mRNA export from the nucleus to the cytoplasm and for correct nuclear pore biogenesis and distribution.probableQ54DS8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JRP, chain A
Confidence level:very confident
Coverage over the Query: 5-160,172-299
View the alignment between query and template
View the model in PyMOL