Citrus Sinensis ID: 022144

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MASTKKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRPFTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMSDESQVDAINPLPLKRANSVGPSNNISGLCLNPGSPSGSDSSDSSLPGVAQSPVCHPLFRTGSLVPVETSSSTTDPPTSLSLSLPGSESCEVSNHGPGSENGSNLVLNPNQVASTQPLQVQAQAQNQGEFGYEKQFFSPEFLAVMQEMIRKEVRNYMSGVERNGLCLPAEAIRNAVVKRIGINKAD
ccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHcccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccc
**************WSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRPFTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTL*********************************************************************************************************************************************QFFSPEFLAVMQEMIRKEVRNYMSGVERNGLCLPAEAIRNAVVKRIGINKA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTKKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRPFTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMSDESQVDAINPLPLKRANSVGPSNNISGLCLNPGSPSGSDSSDSSLPGVAQSPVCHPLFRTGSLVPVETSSSTTDPPTSLSLSLPGSESCEVSNHGPGSENGSNLVLNPNQVASTQPLQVQAQAQNQGEFGYEKQFFSPEFLAVMQEMIRKEVRNYMSGVERNGLCLPAEAIRNAVVKRIGINKAD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor MYB44 Transcription factor. Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA.probableQ9FDW1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZQC, chain A
Confidence level:very confident
Coverage over the Query: 11-119
View the alignment between query and template
View the model in PyMOL