Citrus Sinensis ID: 022155

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--

MGAPMTPQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVER

ccccccHHHHHHccccccccccccHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHcccccccccccEEEEEEccccccHHHHHHHHHHccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccccccccHHHHHHcccEEEEEECccccHHHHcccccccccccccccccccccCEEEEEECccccccCEEEEEECccccccccc

*GAPMTPQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFG***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DNA repair protein XRCC3 homolog	Plays essential roles in DNA damage repair in both somatic and meiotic cells. It is important for postsynaptic events following pachytene in meiosis. It is also required for DNA cross-links repair and is involved in double strand breaks (DSBs) repair.	probable	Q9FKM5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LDA, chain A
Confidence level:very confident
Coverage over the Query: 8-194,228-245,271-301
View the alignment between query and template
View the model in PyMOL