Citrus Sinensis ID: 022155
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 302 | ||||||
| 225446054 | 300 | PREDICTED: DNA repair protein XRCC3 homo | 0.966 | 0.973 | 0.656 | 1e-108 | |
| 147777505 | 2077 | hypothetical protein VITISV_027869 [Viti | 0.966 | 0.140 | 0.656 | 1e-108 | |
| 255581709 | 301 | X-ray repair cross complementing protein | 0.943 | 0.946 | 0.637 | 1e-105 | |
| 449466133 | 294 | PREDICTED: DNA repair protein XRCC3 homo | 0.960 | 0.986 | 0.665 | 1e-104 | |
| 224142257 | 290 | predicted protein [Populus trichocarpa] | 0.940 | 0.979 | 0.625 | 1e-102 | |
| 297735394 | 260 | unnamed protein product [Vitis vinifera] | 0.854 | 0.992 | 0.63 | 1e-97 | |
| 15242137 | 304 | DNA repair protein XRCC3-like protein [A | 0.963 | 0.957 | 0.582 | 1e-96 | |
| 356567224 | 288 | PREDICTED: DNA repair protein XRCC3 homo | 0.900 | 0.944 | 0.562 | 6e-86 | |
| 242065454 | 292 | hypothetical protein SORBIDRAFT_04g02309 | 0.870 | 0.900 | 0.473 | 1e-51 | |
| 413937284 | 291 | hypothetical protein ZEAMMB73_748424 [Ze | 0.824 | 0.855 | 0.477 | 1e-46 |
| >gi|225446054|ref|XP_002268968.1| PREDICTED: DNA repair protein XRCC3 homolog [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 397 bits (1019), Expect = e-108, Method: Compositional matrix adjust.
Identities = 201/306 (65%), Positives = 239/306 (78%), Gaps = 14/306 (4%)
Query: 5 MTPQNLLDNPL--TTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSA 62
M PQNLL NPL TT+KCT+GCPI+DRCL GG+PCNSITELVAESGSGKTQ CLQL LSA
Sbjct: 1 MIPQNLLQNPLALTTQKCTLGCPILDRCLAGGVPCNSITELVAESGSGKTQLCLQLVLSA 60
Query: 63 QLPSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDH------NPCDYIFVQSVHSV 116
QLP+S GGL+ASSLY+H+EFPFP RRL QLS +FR S H NP D++ V+ V S
Sbjct: 61 QLPTSLGGLAASSLYIHSEFPFPSRRLQQLSQSFRSSYSHVLDSEYNPLDFVLVRGVQSA 120
Query: 117 DQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGM 176
DQL D++ K++S + ++LP+RLIVIDSIAALFR +F+NT DLK+RS LFFKISG
Sbjct: 121 DQLFDVLLKMDSVLLRPP-TQLPVRLIVIDSIAALFRGEFENTPFDLKRRSSLFFKISGK 179
Query: 177 LKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNS 236
LKA+A FGLAV+VTNQVVD + G+NGLRVGNLG L+SSGR +C ALG++WANCVNS
Sbjct: 180 LKALAERFGLAVVVTNQVVDFVGQAGGLNGLRVGNLGSLWSSGRRVCAALGLSWANCVNS 239
Query: 237 RLFLSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREG 296
RLFLSRNE+ V G+GG G+ D V R TRR LHV+FAPHL ++SCEF I+REG
Sbjct: 240 RLFLSRNEEIVGEVT-----GLGGVGAGDTVSRLTRRHLHVIFAPHLPESSCEFVISREG 294
Query: 297 VFGVER 302
V GVER
Sbjct: 295 VLGVER 300
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147777505|emb|CAN60498.1| hypothetical protein VITISV_027869 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255581709|ref|XP_002531657.1| X-ray repair cross complementing protein 3, xrcc3, putative [Ricinus communis] gi|223528715|gb|EEF30727.1| X-ray repair cross complementing protein 3, xrcc3, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449466133|ref|XP_004150781.1| PREDICTED: DNA repair protein XRCC3 homolog [Cucumis sativus] gi|449506730|ref|XP_004162832.1| PREDICTED: DNA repair protein XRCC3 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224142257|ref|XP_002324475.1| predicted protein [Populus trichocarpa] gi|222865909|gb|EEF03040.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297735394|emb|CBI17834.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15242137|ref|NP_200554.1| DNA repair protein XRCC3-like protein [Arabidopsis thaliana] gi|30696870|ref|NP_851202.1| DNA repair protein XRCC3-like protein [Arabidopsis thaliana] gi|55583983|sp|Q9FKM5.1|XRCC3_ARATH RecName: Full=DNA repair protein XRCC3 homolog; AltName: Full=X-ray repair cross-complementing protein 3 homolog; Short=AtXRCC3 gi|9758307|dbj|BAB08781.1| unnamed protein product [Arabidopsis thaliana] gi|15425729|dbj|BAB64342.1| AtXRCC3alpha [Arabidopsis thaliana] gi|16444953|dbj|BAB70684.1| AtXRCC3beta [Arabidopsis thaliana] gi|19571703|emb|CAD27641.1| Rad51B protein [Arabidopsis thaliana] gi|19571705|emb|CAD27642.1| Rad51B protein [Arabidopsis thaliana] gi|20384750|gb|AAK54457.1| DNA repair protein XRCC3 [Arabidopsis thaliana] gi|109946499|gb|ABG48428.1| At5g57450 [Arabidopsis thaliana] gi|332009520|gb|AED96903.1| DNA repair protein XRCC3-like protein [Arabidopsis thaliana] gi|332009521|gb|AED96904.1| DNA repair protein XRCC3-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356567224|ref|XP_003551821.1| PREDICTED: DNA repair protein XRCC3 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|242065454|ref|XP_002454016.1| hypothetical protein SORBIDRAFT_04g023090 [Sorghum bicolor] gi|241933847|gb|EES06992.1| hypothetical protein SORBIDRAFT_04g023090 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|413937284|gb|AFW71835.1| hypothetical protein ZEAMMB73_748424 [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 302 | ||||||
| TAIR|locus:2174577 | 304 | XRCC3 "homolog of X-ray repair | 0.956 | 0.950 | 0.586 | 1.7e-91 | |
| DICTYBASE|DDB_G0283637 | 564 | xrcc3 "putative DNA repair pro | 0.324 | 0.173 | 0.474 | 5.8e-38 | |
| UNIPROTKB|O43542 | 346 | XRCC3 "DNA repair protein XRCC | 0.715 | 0.624 | 0.369 | 4.4e-34 | |
| UNIPROTKB|F1S9W9 | 347 | XRCC3 "Uncharacterized protein | 0.698 | 0.608 | 0.355 | 4.4e-34 | |
| UNIPROTKB|E2RAE7 | 349 | XRCC3 "Uncharacterized protein | 0.711 | 0.616 | 0.351 | 4.4e-34 | |
| UNIPROTKB|Q08DH8 | 341 | XRCC3 "DNA repair protein XRCC | 0.695 | 0.615 | 0.359 | 1.1e-33 | |
| UNIPROTKB|Q5ZM26 | 347 | XRCC3 "Uncharacterized protein | 0.854 | 0.743 | 0.353 | 4.2e-31 | |
| ZFIN|ZDB-GENE-050320-116 | 352 | xrcc3 "X-ray repair complement | 0.692 | 0.593 | 0.378 | 8.8e-31 | |
| MGI|MGI:1921585 | 349 | Xrcc3 "X-ray repair complement | 0.731 | 0.633 | 0.356 | 1.2e-28 | |
| RGD|1306849 | 349 | Xrcc3 "X-ray repair complement | 0.731 | 0.633 | 0.340 | 1.3e-27 |
| TAIR|locus:2174577 XRCC3 "homolog of X-ray repair cross complementing 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 912 (326.1 bits), Expect = 1.7e-91, P = 1.7e-91
Identities = 177/302 (58%), Positives = 225/302 (74%)
Query: 7 PQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPS 66
P+NLL T K T GC I+D CL GGI C+S+TE+VAESG GKTQ CLQL+L QLP
Sbjct: 8 PENLLRRSPTNRKLTTGCEILDGCLRGGISCDSLTEIVAESGCGKTQLCLQLSLCTQLPI 67
Query: 67 SHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSN-------DHNPCDYIFVQSVHSVDQL 119
SHGGL+ SSLYLH+EFPFP RRLHQLSHTF SN + NPCD++FVQ+VHSVD L
Sbjct: 68 SHGGLNGSSLYLHSEFPFPFRRLHQLSHTFHQSNPSIYANYNDNPCDHVFVQNVHSVDHL 127
Query: 120 LDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKA 179
DIMP+I+ F+ NS +R P++LIV+DS+AALFRS+FDNT DLKKRS LFFKISG LK
Sbjct: 128 FDIMPRIDGFVGNSK-TRFPLKLIVLDSVAALFRSEFDNTPSDLKKRSSLFFKISGKLKQ 186
Query: 180 MAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLF 239
+A F LA+++TNQV DL+E ++G++GLR+GNL LYSSGR + P+LG+AWANCVNSR F
Sbjct: 187 LASKFDLAIVITNQVTDLVETSDGLSGLRIGNLRYLYSSGRRVVPSLGLAWANCVNSRFF 246
Query: 240 LSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFG 299
+SR++ +V++ + S V R +R L +VF+P+L +SCEF ITREG+
Sbjct: 247 ISRSDGSIVKDRSEKDENCSSS-----VSRSAKRRLDIVFSPYLPGSSCEFMITREGICA 301
Query: 300 VE 301
V+
Sbjct: 302 VQ 303
|
|
| DICTYBASE|DDB_G0283637 xrcc3 "putative DNA repair protein XRCC3" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43542 XRCC3 "DNA repair protein XRCC3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S9W9 XRCC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RAE7 XRCC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q08DH8 XRCC3 "DNA repair protein XRCC3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZM26 XRCC3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050320-116 xrcc3 "X-ray repair complementing defective repair in Chinese hamster cells 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1921585 Xrcc3 "X-ray repair complementing defective repair in Chinese hamster cells 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1306849 Xrcc3 "X-ray repair complementing defective repair in Chinese hamster cells 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 302 | |||
| cd01123 | 235 | cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B | 4e-79 | |
| cd01393 | 226 | cd01393, recA_like, RecA is a bacterial enzyme whi | 1e-64 | |
| TIGR02236 | 310 | TIGR02236, recomb_radA, DNA repair and recombinati | 2e-29 | |
| PRK04301 | 317 | PRK04301, radA, DNA repair and recombination prote | 3e-29 | |
| PLN03186 | 342 | PLN03186, PLN03186, DNA repair protein RAD51 homol | 1e-27 | |
| COG0468 | 279 | COG0468, RecA, RecA/RadA recombinase [DNA replicat | 2e-26 | |
| PTZ00035 | 337 | PTZ00035, PTZ00035, Rad51 protein; Provisional | 2e-26 | |
| PLN03187 | 344 | PLN03187, PLN03187, meiotic recombination protein | 5e-24 | |
| pfam08423 | 261 | pfam08423, Rad51, Rad51 | 1e-23 | |
| TIGR02239 | 316 | TIGR02239, recomb_RAD51, DNA repair protein RAD51 | 8e-23 | |
| TIGR02238 | 313 | TIGR02238, recomb_DMC1, meiotic recombinase Dmc1 | 2e-22 | |
| PRK09361 | 225 | PRK09361, radB, DNA repair and recombination prote | 8e-20 | |
| TIGR02237 | 209 | TIGR02237, recomb_radB, DNA repair and recombinati | 1e-16 | |
| cd01394 | 218 | cd01394, radB, RadB | 4e-16 | |
| COG0467 | 260 | COG0467, RAD55, RecA-superfamily ATPases implicate | 3e-06 | |
| pfam06745 | 231 | pfam06745, KaiC, KaiC | 2e-05 | |
| cd01120 | 165 | cd01120, RecA-like_NTPases, RecA-like NTPases | 2e-05 | |
| cd00983 | 325 | cd00983, recA, RecA is a bacterial enzyme which ha | 4e-05 | |
| COG2874 | 235 | COG2874, FlaH, Predicted ATPases involved in bioge | 2e-04 | |
| PRK08533 | 230 | PRK08533, PRK08533, flagellar accessory protein Fl | 5e-04 | |
| TIGR03881 | 229 | TIGR03881, KaiC_arch_4, KaiC domain protein, PAE11 | 0.003 |
| >gnl|CDD|238543 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
Score = 239 bits (613), Expect = 4e-79
Identities = 89/277 (32%), Positives = 131/277 (47%), Gaps = 44/277 (15%)
Query: 21 TVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHT 80
T G +D LGGGI SITE+ E GSGKTQ C QL ++ QLP GGL ++Y+ T
Sbjct: 2 TTGSKALDELLGGGIETGSITEIFGEFGSGKTQLCHQLAVTVQLPIELGGLEGKAVYIDT 61
Query: 81 EFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPI 140
E F RL Q++ F + D I+V ++ D L ++ ++E+ + SS I
Sbjct: 62 EGTFRPERLVQIAERFGLDPE-EVLDNIYVARAYNSDHQLQLLEELEAILIESSR----I 116
Query: 141 RLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEP 200
+L+++DS+ ALFR++FD +L +R K+ LK +A F +AV++TNQV +
Sbjct: 117 KLVIVDSVTALFRAEFDG-RGELAERQQHLAKLLRTLKRLADEFNVAVVITNQVTARPD- 174
Query: 201 NEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVVRENQMVNGGVGG 260
G G P PA G WA+ +RL+L +
Sbjct: 175 ------------GAAMFGGDPKKPAGGNIWAHASTTRLYLRKG----------------- 205
Query: 261 SGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGV 297
R R +V +PHL + F IT EG+
Sbjct: 206 --------RGEERIAKIVDSPHLPEGEAVFAITEEGI 234
|
This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 . Length = 235 |
| >gnl|CDD|238687 cd01393, recA_like, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >gnl|CDD|131290 TIGR02236, recomb_radA, DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >gnl|CDD|235273 PRK04301, radA, DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178728 PLN03186, PLN03186, DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223544 COG0468, RecA, RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|185407 PTZ00035, PTZ00035, Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215620 PLN03187, PLN03187, meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|117002 pfam08423, Rad51, Rad51 | Back alignment and domain information |
|---|
| >gnl|CDD|233794 TIGR02239, recomb_RAD51, DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >gnl|CDD|131292 TIGR02238, recomb_DMC1, meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >gnl|CDD|236482 PRK09361, radB, DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233793 TIGR02237, recomb_radB, DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >gnl|CDD|238688 cd01394, radB, RadB | Back alignment and domain information |
|---|
| >gnl|CDD|223543 COG0467, RAD55, RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|219158 pfam06745, KaiC, KaiC | Back alignment and domain information |
|---|
| >gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases | Back alignment and domain information |
|---|
| >gnl|CDD|238483 cd00983, recA, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >gnl|CDD|225429 COG2874, FlaH, Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|181459 PRK08533, PRK08533, flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|163593 TIGR03881, KaiC_arch_4, KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 100.0 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 100.0 | |
| KOG1564 | 351 | consensus DNA repair protein RHP57 [Replication, r | 100.0 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 100.0 | |
| KOG1434 | 335 | consensus Meiotic recombination protein Dmc1 [Cell | 100.0 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 100.0 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 100.0 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 100.0 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 100.0 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 100.0 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 100.0 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 100.0 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 100.0 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 100.0 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 100.0 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 100.0 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 100.0 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 100.0 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 100.0 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 100.0 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 99.97 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 99.96 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 99.96 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 99.96 | |
| KOG1433 | 326 | consensus DNA repair protein RAD51/RHP55 [Replicat | 99.95 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 99.95 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 99.95 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 99.95 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 99.95 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 99.94 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 99.91 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 99.91 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 99.91 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 99.9 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 99.9 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 99.89 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 99.89 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 99.87 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 99.82 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 99.8 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 99.79 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 99.78 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 99.77 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 99.77 | |
| KOG2859 | 293 | consensus DNA repair protein, member of the recA/R | 99.76 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 99.76 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 99.76 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 99.74 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 99.74 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 99.74 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 99.73 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 99.73 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 99.72 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 99.72 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 99.72 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 99.71 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 99.71 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 99.71 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 99.71 | |
| COG2874 | 235 | FlaH Predicted ATPases involved in biogenesis of a | 99.69 | |
| PRK06749 | 428 | replicative DNA helicase; Provisional | 99.66 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 99.63 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 99.6 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 99.58 | |
| COG0305 | 435 | DnaB Replicative DNA helicase [DNA replication, re | 99.54 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 99.48 | |
| COG3598 | 402 | RepA RecA-family ATPase [DNA replication, recombin | 99.31 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 99.07 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.0 | |
| KOG2373 | 514 | consensus Predicted mitochondrial DNA helicase twi | 99.0 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 98.93 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 98.92 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 98.91 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 98.9 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 98.89 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 98.89 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 98.88 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 98.86 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 98.82 | |
| PF13479 | 213 | AAA_24: AAA domain | 98.81 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 98.8 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 98.8 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 98.8 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 98.77 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 98.77 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 98.76 | |
| PF07088 | 484 | GvpD: GvpD gas vesicle protein; InterPro: IPR00978 | 98.74 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 98.73 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 98.72 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 98.7 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 98.68 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 98.68 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 98.67 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.67 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 98.66 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 98.65 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 98.63 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 98.63 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 98.62 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 98.62 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 98.59 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 98.59 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 98.58 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 98.56 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 98.55 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 98.55 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 98.53 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 98.53 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 98.51 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.51 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 98.51 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 98.5 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 98.5 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 98.5 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.5 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 98.5 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 98.49 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 98.48 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.48 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 98.48 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 98.48 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 98.47 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.47 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.46 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 98.46 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.46 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 98.45 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 98.45 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 98.45 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.45 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 98.44 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 98.44 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 98.44 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 98.44 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 98.44 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 98.44 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 98.44 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 98.43 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 98.43 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 98.43 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 98.43 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 98.42 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 98.42 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 98.42 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 98.42 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 98.42 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 98.41 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 98.41 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 98.41 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 98.4 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.4 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 98.4 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 98.4 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 98.4 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 98.4 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 98.39 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 98.39 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 98.39 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 98.39 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 98.38 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 98.38 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 98.38 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 98.38 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.37 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 98.37 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 98.37 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 98.37 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 98.37 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 98.37 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 98.37 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 98.36 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.36 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 98.36 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 98.36 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.36 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 98.36 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 98.36 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 98.36 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 98.35 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 98.35 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 98.35 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 98.35 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 98.35 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 98.35 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 98.35 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 98.34 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.34 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 98.34 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 98.34 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.34 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 98.33 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 98.33 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 98.33 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 98.33 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 98.33 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 98.33 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 98.33 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 98.32 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 98.32 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 98.32 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 98.32 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 98.32 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 98.32 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 98.32 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 98.31 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 98.31 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 98.31 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 98.31 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 98.31 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 98.31 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 98.31 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 98.3 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 98.3 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 98.3 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 98.3 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 98.3 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 98.3 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 98.3 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 98.3 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 98.3 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 98.29 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.29 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 98.29 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 98.28 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 98.28 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 98.28 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 98.28 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 98.27 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.27 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 98.27 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 98.27 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.27 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 98.26 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 98.26 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 98.26 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 98.26 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 98.26 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 98.26 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 98.25 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.25 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.24 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 98.24 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 98.24 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 98.24 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 98.24 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.24 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 98.24 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 98.24 | |
| KOG0061 | 613 | consensus Transporter, ABC superfamily (Breast can | 98.23 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 98.23 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 98.23 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 98.22 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 98.22 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 98.22 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 98.22 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 98.22 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 98.21 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 98.21 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 98.21 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 98.21 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 98.21 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 98.21 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 98.21 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 98.2 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.2 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 98.2 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 98.19 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 98.19 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 98.19 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 98.19 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 98.18 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.18 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.17 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 98.17 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 98.16 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 98.16 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 98.16 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 98.16 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 98.16 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 98.16 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 98.15 | |
| COG2087 | 175 | CobU Adenosyl cobinamide kinase/adenosyl cobinamid | 98.15 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.15 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 98.15 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 98.15 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 98.15 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.14 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 98.14 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 98.14 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 98.14 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 98.13 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 98.13 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 98.13 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 98.12 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 98.12 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 98.12 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 98.12 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 98.12 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 98.12 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 98.11 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 98.11 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 98.11 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 98.11 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 98.11 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 98.1 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 98.1 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 98.1 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 98.1 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 98.1 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 98.1 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 98.09 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 98.09 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 98.09 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 98.09 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 98.09 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 98.09 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 98.09 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 98.08 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.08 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 98.08 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 98.08 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 98.08 | |
| PRK07165 | 507 | F0F1 ATP synthase subunit alpha; Validated | 98.08 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 98.07 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 98.07 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 98.07 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 98.07 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 98.07 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 98.06 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 98.06 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 98.06 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 98.06 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 98.06 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 98.06 | |
| TIGR00962 | 501 | atpA proton translocating ATP synthase, F1 alpha s | 98.05 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 98.05 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 98.04 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 98.04 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 98.04 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 98.04 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 98.04 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 98.04 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 98.04 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 98.03 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 98.03 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 98.03 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 98.03 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 98.02 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 98.02 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 98.02 | |
| TIGR03324 | 497 | alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a | 98.01 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 98.01 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 98.01 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 98.0 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 98.0 | |
| PRK13343 | 502 | F0F1 ATP synthase subunit alpha; Provisional | 98.0 | |
| PRK09281 | 502 | F0F1 ATP synthase subunit alpha; Validated | 98.0 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 98.0 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 98.0 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 98.0 | |
| PRK08181 | 269 | transposase; Validated | 97.99 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 97.98 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 97.98 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 97.98 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 97.98 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 97.98 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 97.98 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 97.97 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 97.97 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.96 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.96 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 97.96 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 97.96 | |
| PF02283 | 167 | CobU: Cobinamide kinase / cobinamide phosphate gua | 97.96 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 97.96 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 97.96 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 97.95 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 97.95 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 97.94 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 97.94 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 97.94 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 97.94 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 97.93 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 97.93 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 97.93 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.93 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 97.93 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 97.92 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 97.92 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 97.92 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 97.92 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 97.9 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 97.9 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 97.9 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 97.89 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 97.89 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 97.89 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 97.89 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 97.89 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 97.88 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 97.88 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 97.88 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 97.87 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.87 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 97.86 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 97.86 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.86 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.86 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 97.86 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 97.85 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 97.85 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 97.85 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 97.85 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 97.84 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 97.84 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 97.84 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 97.84 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 97.84 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 97.84 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 97.83 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 97.83 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 97.83 | |
| PRK06526 | 254 | transposase; Provisional | 97.82 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 97.81 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 97.81 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.81 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 97.81 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 97.81 | |
| TIGR01042 | 591 | V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th | 97.81 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 97.81 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 97.81 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 97.81 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 97.8 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 97.8 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 97.8 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 97.8 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 97.79 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 97.79 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 97.79 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 97.79 | |
| PRK08727 | 233 | hypothetical protein; Validated | 97.79 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 97.79 | |
| PRK04196 | 460 | V-type ATP synthase subunit B; Provisional | 97.78 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 97.78 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 97.78 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 97.78 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 97.77 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.77 | |
| PF05729 | 166 | NACHT: NACHT domain | 97.77 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 97.76 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 97.76 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 97.76 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 97.76 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 97.76 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.75 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 97.75 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 97.75 | |
| TIGR01043 | 578 | ATP_syn_A_arch ATP synthase archaeal, A subunit. A | 97.75 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 97.75 | |
| PRK04192 | 586 | V-type ATP synthase subunit A; Provisional | 97.75 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 97.74 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 97.74 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 97.74 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 97.73 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 97.73 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 97.73 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 97.73 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 97.72 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 97.71 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 97.71 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 97.71 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 97.7 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 97.7 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 97.7 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 97.69 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.69 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 97.69 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 97.68 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 97.68 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 97.67 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 97.67 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 97.67 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 97.66 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 97.66 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 97.66 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 97.66 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 97.66 | |
| TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 97.66 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 97.65 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 97.65 | |
| COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 97.64 | |
| COG1157 | 441 | FliI Flagellar biosynthesis/type III secretory pat | 97.64 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 97.64 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 97.64 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 97.63 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 97.61 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.61 | |
| PF05625 | 363 | PAXNEB: PAXNEB protein; InterPro: IPR008728 The RN | 97.6 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 97.6 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 97.6 |
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-53 Score=372.32 Aligned_cols=250 Identities=40% Similarity=0.709 Sum_probs=213.3
Q ss_pred ccccccCCCCCCccccCChhhHhhhCCCCCCCcEEEEEeCCCCcHHHHHHHHHHHccCCCcCCCCCCeEEEEeCCCCCCH
Q 022155 7 PQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPM 86 (302)
Q Consensus 7 ~~~l~~~~~~~~~i~tG~~~LD~~L~GGl~~G~i~ei~G~~GsGKT~l~l~la~~~~l~~~~gg~~~~vlyid~e~~~~~ 86 (302)
..++++.+.....|+||++.||.+|+|||+.|.+|||+|+||||||+||+++|.++++|...||.+++|+|||||++|++
T Consensus 7 a~~~~~~~~~~~~i~Tg~~~lD~~L~GGi~~g~itEi~G~~gsGKTql~l~l~~~~~l~~~~~g~~~~vvyidTe~~f~~ 86 (256)
T PF08423_consen 7 AAELLEQRKRWSRISTGCKSLDELLGGGIPTGSITEIVGESGSGKTQLCLQLAVNVQLPEEIGGLGGKVVYIDTEGTFSP 86 (256)
T ss_dssp HHHHHHHHHTS-EE--SSHHHHHHTTSSEETTSEEEEEESTTSSHHHHHHHHHHHTTSGGCTTSSSSEEEEEESSSSS-H
T ss_pred HHHHHHHhhcCCeeCCCCHHHHHhhCCCCCCCcEEEEEEecccccchHHHHHHHHhhcccccccCCCceEEEeCCCCCCH
Confidence 44678888889999999999999999999999999999999999999999999999998777888889999999999999
Q ss_pred HHHHHHHHHhCCCCCCCCCCcEEEEeCCCHHHHHHHHHHHHHHHHhccCCCCCeeEEEEechhhhhhhccCCChhhHHHH
Q 022155 87 RRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKR 166 (302)
Q Consensus 87 ~rl~~i~~~~~~~~~~~~l~~i~~~~~~~~~~l~~~l~~l~~~l~~~~~~~~~~~lvVIDsi~~~~~~~~~~~~~~~~~r 166 (302)
+|+.+|++.+. ..+++.++|+++.++.+.+++.+++..+...+.+ .+++|||||||+++|+.++.+. +++.+|
T Consensus 87 ~Rl~~i~~~~~-~~~~~~l~~I~v~~~~~~~~l~~~L~~l~~~l~~-----~~ikLIVIDSIaalfr~e~~~~-~~~~~R 159 (256)
T PF08423_consen 87 ERLQQIAERFG-LDPEEILDNIFVIRVFDLEELLELLEQLPKLLSE-----SKIKLIVIDSIAALFRSEFSGR-GDLAER 159 (256)
T ss_dssp HHHHHHHHHTT-S-HHHHHHTEEEEE-SSHHHHHHHHHHHHHHHHH-----SCEEEEEEETSSHHHHHHSGST-TTHHHH
T ss_pred HHHHHHhhccc-cccchhhhceeeeecCCHHHHHHHHHHHHhhccc-----cceEEEEecchHHHHHHHHccc-hhhHHH
Confidence 99999998764 2334578999999999999999999999888875 5799999999999999887654 256789
Q ss_pred HHHHHHHHHHHHHHHHHcCcEEEEEecccccCCCCCCCCCccccCCccccCCCCCccccCCchhhhhcceEEEEEEecCc
Q 022155 167 SFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDF 246 (302)
Q Consensus 167 ~~~l~~l~~~L~~la~~~~~~viv~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~lG~~w~~~~~~rl~l~~~~~~ 246 (302)
++.|.+++..|+++|++|+++||+|||++++++... .+ .....+|+||.+|+|++++||+|+|.+.
T Consensus 160 ~~~L~~~~~~L~~lA~~~~iaVvvTNqv~~~~~~~~------------~~-~~~~~~PalG~~w~h~~~~Rl~l~k~~~- 225 (256)
T PF08423_consen 160 QRMLARLARILKRLARKYNIAVVVTNQVTTKIDSNS------------LF-DGDRLKPALGHSWSHAVTTRLFLSKGRG- 225 (256)
T ss_dssp HHHHHHHHHHHHHHHHHTT-EEEEEEEECSSTT----------------S-STTSEEETTHHHHHHHSSEEEEEEECST-
T ss_pred HHHHHHHHHHHHHHHHhCCceEEeeceeeecCCccc------------cc-ccccceecCcchhhhhccEEEEEEeCCC-
Confidence 999999999999999999999999999998876431 11 1246899999999999999999998543
Q ss_pred hhcccccccCCCCCCCCCCcccccceEEEEEEECCCCCCceeeEEEecCcccccC
Q 022155 247 VVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVE 301 (302)
Q Consensus 247 ~~~~~~~~~g~~~~~~~~~~~~~~~~R~~~v~ks~~~~~~~~~F~I~~~Gi~~~~ 301 (302)
..|.++|.|||..|..++.|.|+++||+|++
T Consensus 226 ------------------------~~R~~~i~ksp~~p~~~~~f~It~~Gi~d~~ 256 (256)
T PF08423_consen 226 ------------------------SERVATIVKSPSLPEGSASFQITEDGIRDVK 256 (256)
T ss_dssp ------------------------TEEEEEEEECSSSSSEEEEEEEETTEEEE--
T ss_pred ------------------------CeEEEEEeECCCCCCceEEEEEeCCCccCCC
Confidence 4899999999999999999999999999974
|
It is critical for DNA binding []. Rad51 is a homologue of the bacterial RecA protein. Rad51 and RecA share a core ATPase domain.; PDB: 2ZUC_A 2Z43_C 2ZUD_B 2DFL_A 2ZUB_A 2BKE_A 2KZ3_A 2CVH_B 2CVF_B 1SZP_D .... |
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >KOG1564 consensus DNA repair protein RHP57 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >KOG1434 consensus Meiotic recombination protein Dmc1 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >KOG1433 consensus DNA repair protein RAD51/RHP55 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >KOG2859 consensus DNA repair protein, member of the recA/RAD51 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK06749 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG2087 CobU Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK07165 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >PRK13343 F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK09281 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >PF02283 CobU: Cobinamide kinase / cobinamide phosphate guanyltransferase; InterPro: IPR003203 This family is composed of a group of bifunctional cobalbumin biosynthesis enzymes which display cobinamide kinase and cobinamide phosphate guanyltransferase activity | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK04196 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >PRK04192 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF05625 PAXNEB: PAXNEB protein; InterPro: IPR008728 The RNA polymerase II elongator complex is a major histone acetyltransferase component of the RNA polymerase II (RNAPII) holoenzyme and is involved in transcriptional elongation [, ] | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 302 | ||||
| 2dfl_A | 324 | Crystal Structure Of Left-Handed Rada Filament Leng | 7e-21 | ||
| 1pzn_A | 349 | Rad51 (Rada) Length = 349 | 1e-20 | ||
| 2bke_A | 324 | Conformational Flexibility Revealed By The Crystal | 8e-20 | ||
| 4b2i_A | 231 | Humanised Monomeric Rada In Complex With Indazole L | 1e-19 | ||
| 4a6p_A | 231 | Rada C-Terminal Atpase Domain From Pyrococcus Furio | 2e-19 | ||
| 1n0w_A | 243 | Crystal Structure Of A Rad51-Brca2 Brc Repeat Compl | 2e-14 | ||
| 1v5w_A | 343 | Crystal Structure Of The Human Dmc1 Protein Length | 2e-14 | ||
| 3lda_A | 400 | Yeast Rad51 H352y Filament Interface Mutant Length | 3e-14 | ||
| 2zjb_A | 343 | Crystal Structure Of The Human Dmc1-M200v Polymorph | 3e-14 | ||
| 1szp_A | 321 | A Crystal Structure Of The Rad51 Filament Length = | 4e-14 | ||
| 1t4g_A | 322 | Atpase In Complex With Amp-pnp Length = 322 | 7e-13 | ||
| 3ntu_A | 319 | Rada Recombinase D302k Mutant In Complex With Amp-P | 8e-13 | ||
| 2gdj_A | 264 | Delta-62 Rada Recombinase In Complex With Amp-Pnp A | 9e-13 | ||
| 4dc9_A | 266 | Hexameric Ring Of Methanococcus Voltae Rada Length | 9e-13 | ||
| 2f1h_A | 322 | Recombinase In Complex With Amp-pnp And Potassium L | 2e-12 | ||
| 3etl_A | 322 | Rada Recombinase From Methanococcus Maripaludis In | 5e-12 | ||
| 2cvf_A | 220 | Crystal Structure Of The Radb Recombinase Length = | 8e-04 |
| >pdb|2DFL|A Chain A, Crystal Structure Of Left-Handed Rada Filament Length = 324 | Back alignment and structure |
|
| >pdb|1PZN|A Chain A, Rad51 (Rada) Length = 349 | Back alignment and structure |
| >pdb|2BKE|A Chain A, Conformational Flexibility Revealed By The Crystal Structure Of A Crenarchaeal Rada Length = 324 | Back alignment and structure |
| >pdb|4B2I|A Chain A, Humanised Monomeric Rada In Complex With Indazole Length = 231 | Back alignment and structure |
| >pdb|4A6P|A Chain A, Rada C-Terminal Atpase Domain From Pyrococcus Furiosus Length = 231 | Back alignment and structure |
| >pdb|1N0W|A Chain A, Crystal Structure Of A Rad51-Brca2 Brc Repeat Complex Length = 243 | Back alignment and structure |
| >pdb|1V5W|A Chain A, Crystal Structure Of The Human Dmc1 Protein Length = 343 | Back alignment and structure |
| >pdb|3LDA|A Chain A, Yeast Rad51 H352y Filament Interface Mutant Length = 400 | Back alignment and structure |
| >pdb|2ZJB|A Chain A, Crystal Structure Of The Human Dmc1-M200v Polymorphic Variant Length = 343 | Back alignment and structure |
| >pdb|1SZP|A Chain A, A Crystal Structure Of The Rad51 Filament Length = 321 | Back alignment and structure |
| >pdb|1T4G|A Chain A, Atpase In Complex With Amp-pnp Length = 322 | Back alignment and structure |
| >pdb|3NTU|A Chain A, Rada Recombinase D302k Mutant In Complex With Amp-Pnp Length = 319 | Back alignment and structure |
| >pdb|2GDJ|A Chain A, Delta-62 Rada Recombinase In Complex With Amp-Pnp And Magnesium Length = 264 | Back alignment and structure |
| >pdb|4DC9|A Chain A, Hexameric Ring Of Methanococcus Voltae Rada Length = 266 | Back alignment and structure |
| >pdb|2F1H|A Chain A, Recombinase In Complex With Amp-pnp And Potassium Length = 322 | Back alignment and structure |
| >pdb|3ETL|A Chain A, Rada Recombinase From Methanococcus Maripaludis In Complex With Amppnp Length = 322 | Back alignment and structure |
| >pdb|2CVF|A Chain A, Crystal Structure Of The Radb Recombinase Length = 220 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 302 | |||
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 1e-70 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 2e-66 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 3e-63 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 3e-59 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 6e-59 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 1e-52 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 2e-21 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 1e-10 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 8e-10 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 9e-10 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 2e-09 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 4e-09 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 |
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Length = 324 | Back alignment and structure |
|---|
Score = 220 bits (562), Expect = 1e-70
Identities = 76/296 (25%), Positives = 122/296 (41%), Gaps = 47/296 (15%)
Query: 6 TPQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLP 65
T + + +K + G +D L GGI ++TE E GSGKTQ C QL+++ QLP
Sbjct: 75 TALEVKKERMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLP 134
Query: 66 SSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPK 125
GGLS ++Y+ TE F R+ ++ D N + I+ + D + I+
Sbjct: 135 PEKGGLSGKAVYIDTEGTFRWERIENMAKALGLDID-NVMNNIYYIRAINTDHQIAIVDD 193
Query: 126 IESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFG 185
++ + I+LIV+DS+ + FR+++ ++L R K L +A +
Sbjct: 194 LQELVSKDP----SIKLIVVDSVTSHFRAEYPGR-ENLAVRQQKLNKHLHQLTRLAEVYD 248
Query: 186 LAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNED 245
+AV++TNQV+ R G P G + R+ L ++
Sbjct: 249 IAVIITNQVMA-----------RPDM-----FYGDPTVAVGGHTLYHVPGIRIQLKKS-- 290
Query: 246 FVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVE 301
R RR VV APHL + F +T EG+ E
Sbjct: 291 -----------------------RGNRRIARVVDAPHLPEGEVVFALTEEGIRDAE 323
|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Length = 343 | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Length = 243 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Length = 349 | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Length = 400 | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Length = 322 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Length = 220 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Length = 235 | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Length = 247 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Length = 279 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 100.0 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 100.0 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 100.0 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 100.0 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 100.0 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 100.0 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 100.0 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 100.0 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 99.97 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 99.97 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 99.97 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 99.97 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 99.97 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 99.96 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 99.95 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 99.95 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 99.94 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 99.93 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 99.92 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 99.91 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 99.9 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 99.89 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 99.87 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 99.87 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 99.85 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 99.83 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 99.82 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 99.81 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 99.79 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 99.77 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 99.69 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 99.61 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 99.55 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 98.71 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 98.67 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 98.65 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 98.63 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 98.59 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 98.57 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 98.57 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 98.48 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 98.45 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 98.45 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 98.44 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 98.44 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 98.41 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 98.4 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 98.4 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 98.39 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 98.39 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 98.39 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 98.39 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 98.37 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 98.33 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 98.33 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 98.31 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 98.31 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 98.31 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 98.3 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 98.29 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 98.27 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 98.26 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 98.26 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 98.25 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 98.24 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 98.23 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 98.21 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 98.21 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 98.2 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.17 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 98.17 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 98.17 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 98.16 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 98.16 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 98.16 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 98.15 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 98.11 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 98.09 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 98.08 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 98.08 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 98.08 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 98.08 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 98.07 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 98.02 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.01 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 98.01 | |
| 4a8j_A | 361 | Elongator complex protein 4; transcription; 2.10A | 98.01 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 98.01 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 98.0 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 98.0 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 97.98 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 97.97 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 97.96 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 97.96 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 97.94 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 97.94 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 97.93 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 97.92 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 97.91 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.91 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.88 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 97.88 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 97.87 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 97.86 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 97.86 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 97.85 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 97.85 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 97.85 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 97.85 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 97.84 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.84 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.84 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 97.82 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.82 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 97.8 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.8 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 97.79 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 97.75 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 97.75 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 97.74 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 97.74 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.74 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 97.73 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 97.71 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 97.7 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 97.7 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 97.67 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.67 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 97.67 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 97.65 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 97.62 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 97.62 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 97.61 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 97.61 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 97.61 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 97.59 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 97.57 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 97.56 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 97.54 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 97.53 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 97.52 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 97.52 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 97.51 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 97.5 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 97.5 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.5 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.5 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 97.5 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 97.5 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 97.49 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.48 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 97.46 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.46 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.46 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 97.45 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.45 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.44 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 97.44 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.44 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 97.44 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 97.43 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 97.4 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 97.39 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 97.38 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 97.37 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 97.37 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 97.36 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 97.35 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.34 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 97.34 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 97.34 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.33 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 97.33 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 97.33 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.32 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 97.32 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 97.31 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 97.31 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 97.31 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 97.3 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 97.3 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 97.29 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 97.29 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 97.28 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 97.28 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 97.27 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 97.26 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 97.25 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.24 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 97.22 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 97.22 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 97.21 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 97.2 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 97.2 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 97.18 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 97.17 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 97.16 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 97.15 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.15 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 97.14 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 97.14 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 97.14 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 97.13 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 97.11 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 97.1 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 97.08 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 97.06 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 97.06 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 97.05 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 97.05 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.04 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 97.0 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 97.0 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 96.98 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.97 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 96.97 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 96.95 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.94 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 96.92 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.88 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 96.87 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 96.85 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 96.85 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 96.85 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 96.85 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 96.84 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 96.84 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 96.82 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 96.82 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 96.8 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 96.8 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 96.8 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 96.79 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 96.79 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 96.78 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 96.78 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 96.77 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 96.77 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 96.77 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 96.75 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 96.74 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 96.74 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 96.74 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 96.73 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 96.72 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 96.7 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 96.69 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 96.69 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 96.69 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 96.68 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 96.67 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 96.66 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 96.66 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 96.65 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 96.64 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 96.64 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.62 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 96.62 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 96.61 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 96.61 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 96.6 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 96.6 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 96.59 | |
| 1oft_A | 161 | SULA, hypothetical protein PA3008; bacterial cell | 96.59 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 96.59 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 96.58 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 96.57 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 96.57 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 96.55 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.52 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 96.51 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 96.51 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 96.5 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 96.5 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 96.5 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 96.46 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 96.45 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 96.45 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 96.41 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 96.38 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 96.37 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 96.35 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 96.35 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 96.35 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 96.34 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.34 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 96.33 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 96.32 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 96.3 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 96.29 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 96.28 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 96.27 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 96.27 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 96.25 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 96.25 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 96.24 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 96.21 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.2 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 96.19 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 96.19 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.18 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 96.17 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 96.17 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 96.16 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 96.16 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 96.15 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 96.14 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.13 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 96.12 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 96.12 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 96.11 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 96.1 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 96.09 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 96.09 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 96.06 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 96.06 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 96.05 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 96.05 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.05 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 96.05 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 96.05 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 96.02 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 96.01 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.0 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 95.97 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 95.95 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 95.95 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 95.94 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 95.94 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 95.91 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 95.91 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 95.89 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 95.89 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 95.89 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 95.88 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 95.87 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 95.84 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 95.82 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 95.81 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 95.81 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 95.8 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 95.78 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 95.77 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 95.76 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 95.76 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 95.74 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 95.74 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 95.72 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 95.72 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 95.72 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 95.71 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.69 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 95.65 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 95.64 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 95.61 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 95.6 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 95.58 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 95.57 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 95.57 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 95.57 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 95.57 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 95.56 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 95.55 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 95.55 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 95.54 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 95.53 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 95.5 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 95.5 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 95.49 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 95.45 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 95.44 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 95.44 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 95.34 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 95.34 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 95.32 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 95.3 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 95.3 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 95.29 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 95.29 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 95.28 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 95.28 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 95.27 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 95.19 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 95.18 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 95.17 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 95.16 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 95.16 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 95.16 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 95.13 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 95.12 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 95.09 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 95.09 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 95.09 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 95.09 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 95.08 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 95.07 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 95.06 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 95.05 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 95.03 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 95.03 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 94.98 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 94.98 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 94.95 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 94.95 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 94.93 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 94.93 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 94.91 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 94.91 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 94.91 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 94.9 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 94.9 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 94.88 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 94.86 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 94.79 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 94.75 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 94.73 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 94.71 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 94.7 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 94.68 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 94.66 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 94.63 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 94.61 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 94.52 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 94.51 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 94.48 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 94.4 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 94.38 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 94.37 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 94.35 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 94.34 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 94.32 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 94.31 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 94.3 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 94.3 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 94.3 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 94.28 | |
| 4eq6_A | 214 | Chromosome segregation in meiosis protein 2; DNA b | 94.26 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 94.26 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 94.23 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 94.19 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 94.17 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 94.14 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 94.12 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 94.11 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 94.1 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 94.04 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 94.03 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 94.02 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 94.01 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 94.0 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 93.99 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 93.97 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 93.97 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 93.91 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 93.9 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 93.89 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 93.87 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 93.87 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 93.86 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 93.8 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 93.78 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 93.78 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 93.78 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 93.73 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 93.73 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 93.71 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 93.7 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 93.7 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 93.7 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 93.69 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 93.68 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 93.66 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 93.65 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 93.65 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 93.64 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 93.59 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 93.56 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 93.55 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 93.54 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 93.52 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 93.48 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 93.46 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 93.46 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 93.43 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 93.39 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 93.39 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 93.37 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 93.37 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 93.35 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 93.32 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 93.32 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 93.26 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 93.25 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 93.24 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 93.23 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 93.22 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 93.22 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 93.21 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 93.2 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 93.19 |
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
Probab=100.00 E-value=3.1e-38 Score=286.80 Aligned_cols=248 Identities=25% Similarity=0.383 Sum_probs=193.0
Q ss_pred cccCCCCCCccccCChhhHhhhCCCCCCCcEEEEEeCCCCcHHHHHHHHHHHccCCCcCCCCCCeEEEEeCCCCCCHHHH
Q 022155 10 LLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRL 89 (302)
Q Consensus 10 l~~~~~~~~~i~tG~~~LD~~L~GGl~~G~i~ei~G~~GsGKT~l~l~la~~~~l~~~~gg~~~~vlyid~e~~~~~~rl 89 (302)
+++.+.....++||++.||.+|+||+++|++++|+||||+|||+||++++.+++++...||...+|+||++|.+|+++++
T Consensus 94 ~~~~~~~~~~i~TG~~~LD~~LgGGl~~G~i~~I~G~~GsGKTtla~~la~~~~~~~~~gg~~~~vlyi~~E~~~~~~~l 173 (343)
T 1v5w_A 94 YSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRL 173 (343)
T ss_dssp HHHHGGGCCCBCCSCHHHHHHTTSSBCSSEEEEEECCTTCTHHHHHHHHHHHTTSCBTTTBCCCEEEEEESSSCCCHHHH
T ss_pred HHhhhcccceeecCChhHHHHhcCCCCCCeEEEEECCCCCCHHHHHHHHHHHHhcccccCCCCCeEEEEECCCCCCHHHH
Confidence 44555567899999999999999999999999999999999999999999998776554444559999999999999999
Q ss_pred HHHHHHhCCCCCCCCCCcEEEEeCCCHHHHHHHHHHHHHHHHhccCCC-CCeeEEEEechhhhhhhccCCChhhHHHHHH
Q 022155 90 HQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSR-LPIRLIVIDSIAALFRSDFDNTMDDLKKRSF 168 (302)
Q Consensus 90 ~~i~~~~~~~~~~~~l~~i~~~~~~~~~~l~~~l~~l~~~l~~~~~~~-~~~~lvVIDsi~~~~~~~~~~~~~~~~~r~~ 168 (302)
.+++..+.. ..+..++++++.++.+.+++.+++..+..++.+ . .++++|||||++++++.++.+. +++..|++
T Consensus 174 ~~~~~~~g~-~~~~~l~~l~~~~~~~~e~~~~ll~~l~~~i~~----~~~~~~lvVIDsl~~l~~~~~~~~-g~~~~r~~ 247 (343)
T 1v5w_A 174 RDIADRFNV-DHDAVLDNVLYARAYTSEHQMELLDYVAAKFHE----EAGIFKLLIIDSIMALFRVDFSGR-GELAERQQ 247 (343)
T ss_dssp HHHHHHTTC-CHHHHHHTEEEEECCSTTHHHHHHHHHHHHHHH----SCSSEEEEEEETSGGGHHHHCCGG-GCHHHHHH
T ss_pred HHHHHHcCC-CHHHHHhceeEeecCCHHHHHHHHHHHHHHHHh----cCCCccEEEEechHHHHHHHhccc-ccHHHHHH
Confidence 888876542 222345788888888888887888777777753 2 5789999999999997765432 24566777
Q ss_pred HHHHHHHHHHHHHHHcCcEEEEEecccccCCCCCCCCCccccCCccccCCCCCccccCCchhhhhcceEEEEEEecCchh
Q 022155 169 LFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVV 248 (302)
Q Consensus 169 ~l~~l~~~L~~la~~~~~~viv~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~lG~~w~~~~~~rl~l~~~~~~~~ 248 (302)
.+.++++.|+.++++++++||++||+.+...... ++. +...+|++|..|.|.+++||+|+|.+.
T Consensus 248 ~l~~~l~~L~~la~~~~~~Vi~~nq~~~~~~~~~------------~~~-g~~~~~~gg~~i~~~ad~~l~l~r~~~--- 311 (343)
T 1v5w_A 248 KLAQMLSRLQKISEEYNVAVFVTNQMTADPGATM------------TFQ-ADPKKPIGGHILAHASTTRISLRKGRG--- 311 (343)
T ss_dssp HHHHHHHHHHHHHHHHTCEEEEEECC--------------------------------CCTTTTSSSEEEEEEESST---
T ss_pred HHHHHHHHHHHHHHHhCCEEEEEeeceecCCCcc------------ccC-CCCCcCCchHHHHHhCCEEEEEEEcCC---
Confidence 7899999999999999999999999987654310 110 134689999999999999999998532
Q ss_pred cccccccCCCCCCCCCCcccccceEEEEEEECCCCCCceeeEEEecCcccccC
Q 022155 249 RENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVE 301 (302)
Q Consensus 249 ~~~~~~~g~~~~~~~~~~~~~~~~R~~~v~ks~~~~~~~~~F~I~~~Gi~~~~ 301 (302)
..|.++|.|+|+.|...+.|.|++.||++++
T Consensus 312 ----------------------~~r~~~v~K~r~~p~~~~~f~I~~~Gi~~~~ 342 (343)
T 1v5w_A 312 ----------------------ELRIAKIYDSPEMPENEATFAITAGGIGDAK 342 (343)
T ss_dssp ----------------------TEEEEEEEECTTCCSSCEEEEEETTEEEECC
T ss_pred ----------------------CEEEEEEEECCCCCCeeEEEEEeCCCccCCC
Confidence 4789999999999988999999999999886
|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >4a8j_A Elongator complex protein 4; transcription; 2.10A {Saccharomyces cerevisiae} PDB: 4ejs_A | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1oft_A SULA, hypothetical protein PA3008; bacterial cell division inhibitor, FTSZ, SULA protein; 2.9A {Pseudomonas aeruginosa} SCOP: c.37.1.22 | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >4eq6_A Chromosome segregation in meiosis protein 2; DNA binding protein; 1.80A {Saccharomyces cerevisiae} PDB: 4dt1_A | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 302 | ||||
| d1v5wa_ | 258 | c.37.1.11 (A:) Meiotic recombination protein DMC1/ | 6e-34 | |
| d1pzna2 | 254 | c.37.1.11 (A:96-349) DNA repair protein Rad51, cat | 6e-33 | |
| d1szpa2 | 251 | c.37.1.11 (A:145-395) DNA repair protein Rad51, ca | 1e-30 | |
| d1n0wa_ | 242 | c.37.1.11 (A:) DNA repair protein Rad51, catalytic | 2e-28 | |
| d2i1qa2 | 258 | c.37.1.11 (A:65-322) DNA repair protein Rad51, cat | 3e-28 | |
| d1xp8a1 | 268 | c.37.1.11 (A:15-282) RecA protein, ATPase-domain { | 3e-20 | |
| d1u94a1 | 263 | c.37.1.11 (A:6-268) RecA protein, ATPase-domain {E | 7e-20 | |
| d1mo6a1 | 269 | c.37.1.11 (A:1-269) RecA protein, ATPase-domain {M | 1e-16 | |
| d1tf7a2 | 242 | c.37.1.11 (A:256-497) Circadian clock protein KaiC | 1e-11 | |
| d1tf7a1 | 242 | c.37.1.11 (A:14-255) Circadian clock protein KaiC | 5e-10 | |
| d1nlfa_ | 274 | c.37.1.11 (A:) Hexameric replicative helicase repA | 1e-06 | |
| d1cr2a_ | 277 | c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), | 0.003 |
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: Meiotic recombination protein DMC1/LIM15 homolog species: Human (Homo sapiens) [TaxId: 9606]
Score = 122 bits (306), Expect = 6e-34
Identities = 62/297 (20%), Positives = 110/297 (37%), Gaps = 43/297 (14%)
Query: 5 MTPQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQL 64
+T + T G D+ LGGGI +ITE E +GKTQ L ++AQL
Sbjct: 4 LTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQL 63
Query: 65 PSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMP 124
P + G +++ TE F RL ++ + D + ++ + ++++
Sbjct: 64 PGAGGYPGGKIIFIDTENTFRPDRLRDIAD-RFNVDHDAVLDNVLYARAYTSEHQMELLD 122
Query: 125 KIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGF 184
+ + + +L++IDSI ALFR DF +L +R ++ L+ ++ +
Sbjct: 123 YVAAKFHEEAG---IFKLLIIDSIMALFRVDFSG-RGELAERQQKLAQMLSRLQKISEEY 178
Query: 185 GLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNE 244
+AV VTNQ+ P P G A+ +R+ L +
Sbjct: 179 NVAVFVTNQMTADPGATMT-------------FQADPKKPIGGHILAHASTTRISLRKG- 224
Query: 245 DFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVE 301
R R + +P + + F IT G+ +
Sbjct: 225 ------------------------RGELRIAKIYDSPEMPENEATFAITAGGIGDAK 257
|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 254 | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 258 | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Length = 268 | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Length = 263 | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 269 | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Length = 277 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 100.0 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 100.0 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 100.0 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 100.0 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 100.0 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 100.0 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 100.0 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 99.97 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 99.95 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 99.94 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 99.87 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 99.82 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.0 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 98.97 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 98.97 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 98.8 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 98.8 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 98.8 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 98.71 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 98.69 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 98.67 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 98.55 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 98.54 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 98.52 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 98.5 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 98.48 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 98.46 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 98.46 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 98.46 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.45 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 98.43 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 98.41 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 98.39 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 98.39 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 98.38 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 98.34 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 98.3 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.29 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.28 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 98.12 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 98.11 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.05 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 98.0 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.95 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 97.87 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 97.81 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 97.81 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.71 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 97.7 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.59 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.57 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 97.54 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 97.5 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.49 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 97.43 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 97.41 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 97.38 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 97.37 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 97.35 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 97.33 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 97.32 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.3 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.29 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 97.29 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.28 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.27 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 97.25 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.22 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 97.22 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 97.21 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 97.21 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 97.2 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.2 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 97.14 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.14 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 97.14 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.13 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.12 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.04 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 97.03 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 97.0 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.98 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 96.96 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 96.94 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 96.91 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 96.91 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.9 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 96.89 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 96.87 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.83 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.82 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 96.8 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 96.75 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.73 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 96.73 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.71 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.69 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.63 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 96.6 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 96.59 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 96.57 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 96.56 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.54 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 96.49 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.47 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 96.45 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 96.45 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 96.44 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 96.4 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.4 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.38 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 96.32 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 96.3 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 96.29 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 96.28 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 96.25 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 96.21 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 96.18 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 96.16 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 96.14 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.11 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 96.1 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.05 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.05 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 95.99 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 95.91 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 95.9 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 95.87 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 95.85 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 95.83 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 95.82 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 95.81 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 95.8 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 95.75 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 95.7 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 95.67 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 95.65 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 95.63 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 95.61 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 95.57 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 95.52 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 95.43 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 95.36 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 95.34 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.24 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 95.23 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 95.22 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 95.19 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 95.15 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 95.11 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 95.1 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 95.03 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 94.98 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 94.97 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 94.96 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 94.9 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 94.88 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.87 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 94.82 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 94.82 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.78 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 94.77 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.73 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 94.69 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 94.62 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 94.58 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 94.58 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 94.46 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 94.43 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 94.41 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 94.41 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 94.4 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 94.39 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 94.38 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 94.36 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 94.27 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 94.25 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 94.2 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 94.18 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 94.16 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.12 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 94.11 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 94.11 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 94.09 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 94.09 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 94.04 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 93.99 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 93.98 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 93.96 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 93.93 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 93.9 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 93.89 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 93.87 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 93.85 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 93.83 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 93.83 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 93.79 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 93.79 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 93.76 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 93.73 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 93.72 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 93.71 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 93.67 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 93.67 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 93.65 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 93.64 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 93.6 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 93.54 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 93.51 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 93.51 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 93.51 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 93.51 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 93.45 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 93.44 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 93.41 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 93.34 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 93.34 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 93.3 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 93.26 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 93.24 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 93.18 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 93.1 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 93.09 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 93.07 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 93.05 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 93.05 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 93.0 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 92.95 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 92.93 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 92.79 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 92.79 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 92.77 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 92.7 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 92.66 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 92.44 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 92.41 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 92.32 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 92.26 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 92.23 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 92.21 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 92.17 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 92.05 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 92.0 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 91.75 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 91.64 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 91.4 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 91.38 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 91.23 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 91.19 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 90.87 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 90.8 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 90.71 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 90.44 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 89.99 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 89.69 | |
| d1j3ba1 | 318 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 89.23 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 89.05 | |
| d2olra1 | 313 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 88.77 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 88.7 | |
| d1ii2a1 | 323 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 88.18 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 87.86 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 87.27 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 87.07 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 86.17 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 85.83 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 85.16 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 84.56 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 84.05 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 83.93 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 83.78 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 82.39 |
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: RecA protein, ATPase-domain species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=1.4e-38 Score=275.14 Aligned_cols=230 Identities=23% Similarity=0.292 Sum_probs=173.4
Q ss_pred CCCCCCccccCChhhHhhhC-CCCCCCcEEEEEeCCCCcHHHHHHHHHHHccCCCcCCCCCCeEEEEeCCCCCCHHHHHH
Q 022155 13 NPLTTEKCTVGCPIIDRCLG-GGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRLHQ 91 (302)
Q Consensus 13 ~~~~~~~i~tG~~~LD~~L~-GGl~~G~i~ei~G~~GsGKT~l~l~la~~~~l~~~~gg~~~~vlyid~e~~~~~~rl~~ 91 (302)
.....++||||++.||.+|+ ||||+|.+++|+||||+||||||++++++++ ..|+ .|+|||+|++++++|++.
T Consensus 28 ~~~~~~~isTG~~~lD~~Lg~GGi~~g~itei~G~~gsGKTtl~l~~~~~~q---~~g~---~~vyidtE~~~~~~~a~~ 101 (263)
T d1u94a1 28 RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQ---REGK---TCAFIDAEHALDPIYARK 101 (263)
T ss_dssp CBCCCCEECCSCHHHHHHTSSSSEETTSEEEEECSTTSSHHHHHHHHHHHHH---HTTC---CEEEEESSCCCCHHHHHH
T ss_pred cCCCCCeEccCCHHHHHHhcCCCccCceEEEEecCCCcHHHHHHHHHHHHHH---cCCC---EEEEEccccccCHHHHHH
Confidence 44457899999999999997 9999999999999999999999999999998 5566 899999999999998877
Q ss_pred HHHHhCCCCCCCCCCcEEEEeCCCHHHHHHHHHHHHHHHHhccCCCCCeeEEEEechhhhhh-hccCCChh--hHHHHHH
Q 022155 92 LSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFR-SDFDNTMD--DLKKRSF 168 (302)
Q Consensus 92 i~~~~~~~~~~~~l~~i~~~~~~~~~~l~~~l~~l~~~l~~~~~~~~~~~lvVIDsi~~~~~-~~~~~~~~--~~~~r~~ 168 (302)
++. .++++++.++.+.++..+.+.. ++.+ .++++|||||++++++ .++..+.+ ....+.+
T Consensus 102 ~Gv---------d~d~v~~~~~~~~E~~~~~i~~---l~~~-----~~~~liViDSi~al~~~~e~~~~~~~~~~~~~a~ 164 (263)
T d1u94a1 102 LGV---------DIDNLLCSQPDTGEQALEICDA---LARS-----GAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAAR 164 (263)
T ss_dssp TTC---------CGGGCEEECCSSHHHHHHHHHH---HHHH-----TCCSEEEEECGGGCCCHHHHTTC------CHHHH
T ss_pred hCC---------CHHHEEEecCCCHHHHHHHHHH---HHhc-----CCCCEEEEECccccccchhcccccccchHHHHHH
Confidence 752 3578999999988887666544 4443 5679999999999984 23322211 2334566
Q ss_pred HHHHHHHHHHHHHHHcCcEEEEEecccccCCCCCCCCCccccCCccccCCCCCccccCCchhhhhcceEEEEEEecCchh
Q 022155 169 LFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVV 248 (302)
Q Consensus 169 ~l~~l~~~L~~la~~~~~~viv~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~lG~~w~~~~~~rl~l~~~~~~~~ 248 (302)
.+..+++.|..++.++++++|++||++.++...+ +.+.+|++|.+|.|++++||.|.|....+
T Consensus 165 ~l~~~~~~l~~~~~~~~~~vi~~NQv~~~~~~~~----------------g~~~~~~GG~al~~~~~~rl~l~k~~~~k- 227 (263)
T d1u94a1 165 MMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMF----------------GNPETTTGGNALKFYASVRLDIRRIGAVK- 227 (263)
T ss_dssp HHHHHHHHHHHHHHHHTCEEEEEEC------------------------------CTTCSHHHHHCSEEEEEEEEEEEE-
T ss_pred HHHHHHHHHHHhhhccCceEEEEEEEEecccccc----------------CCCccccccchhheeeEEEEEEEeccccc-
Confidence 7889999999999999999999999998776432 23568999999999999999998865421
Q ss_pred cccccccCCCCCCCCCCcccccceEEEEEEECCCCC-CceeeEEEe-cCcc
Q 022155 249 RENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLA-DTSCEFEIT-REGV 297 (302)
Q Consensus 249 ~~~~~~~g~~~~~~~~~~~~~~~~R~~~v~ks~~~~-~~~~~F~I~-~~Gi 297 (302)
++.... ..+++++++|++..| ...+.|.|+ ++||
T Consensus 228 -~g~~~i--------------G~~~r~~v~Knr~~~p~~~~~f~i~~~~GI 263 (263)
T d1u94a1 228 -EGENVV--------------GSETRVKVVKNKIAAPFKQAEFQILYGEGI 263 (263)
T ss_dssp -SSSSEE--------------EEEEEEEEEEESSBCSCCEEEEEEETTTEE
T ss_pred -cCCcee--------------eeEEEEEEEeCCCCCCCCEEEEEEEcCCCC
Confidence 111122 256678999998774 568999999 8887
|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|