Citrus Sinensis ID: 022155


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MGAPMTPQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVER
ccccccHHHHHHccccccccccccHHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHHcccccccccccEEEEEEccccccHHHHHHHHHHccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccccccccHHHHHHcccEEEEEEEccccHHHHcccccccccccccccccccccEEEEEEEEccccccEEEEEEEEccccccccc
ccccccHHHHHHHHHHHHEEccccHHHHHHHccccccccEHHHHccccccccEEEEEEEEEEEccccccccccEEEEEEccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccEEEEEEEcHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcEEEEccccccccccEEEEccHHHHHccccccccccEEEEEcccEEEEEEccccccEEEEEEEEEccccccccccccccccEEEEEEcccccccccEEEEEcccccccccc
mgapmtpqnlldnplttekctvgcpiidrclgggipcnsITELVaesgsgktqFCLQLTlsaqlpsshgglsasslylhtefpfpmrrlhqlshtfrpsndhnpcdyifvQSVHSVDQLLDIMPKIESFIknssnsrlpiRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQvvdlmepnegvnglrvgnlgclyssgrpicpalGIAWANcvnsrlflsrneDFVVRENqmvnggvggsgsedfvCRRTrrslhvvfaphladtscefeitregvfgver
mgapmtpqnlldnplttEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFiknssnsrlpiRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVVRENQmvnggvggsgseDFVCRRTRRSLHVvfaphladtscefeitregvfgver
MGAPMTPQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVER
**************LTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQL****GGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVF****
*GAPMTPQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRLHQL**********NPCDYIFVQSVHSVDQLLDIMPKIESFIKN*SNSRLPIRLIVIDSIAALFRSDFDN*****KKRSFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVV****************DFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFG***
********NLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVER
*GAPMTPQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGV*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAPMTPQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVER
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query302 2.2.26 [Sep-21-2011]
Q9FKM5304 DNA repair protein XRCC3 yes no 0.963 0.957 0.582 2e-98
Q9CXE6349 DNA repair protein XRCC3 yes no 0.857 0.742 0.341 6e-35
O43542346 DNA repair protein XRCC3 yes no 0.847 0.739 0.347 3e-34
Q08DH8341 DNA repair protein XRCC3 yes no 0.827 0.733 0.346 4e-34
O35719350 DNA repair protein RAD51 no no 0.675 0.582 0.316 1e-23
B1YC14330 DNA repair and recombinat yes no 0.685 0.627 0.3 1e-23
P0CW91319 DNA repair and recombinat yes no 0.807 0.764 0.284 1e-23
P0CW92319 DNA repair and recombinat yes no 0.807 0.764 0.284 2e-23
A3MXX9332 DNA repair and recombinat yes no 0.675 0.614 0.303 3e-23
Q8ZYR9333 DNA repair and recombinat yes no 0.675 0.612 0.303 4e-23
>sp|Q9FKM5|XRCC3_ARATH DNA repair protein XRCC3 homolog OS=Arabidopsis thaliana GN=XRCC3 PE=1 SV=1 Back     alignment and function desciption
 Score =  358 bits (920), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 177/304 (58%), Positives = 226/304 (74%), Gaps = 13/304 (4%)

Query: 5   MTPQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQL 64
           + P+NLL    T  K T GC I+D CL GGI C+S+TE+VAESG GKTQ CLQL+L  QL
Sbjct: 6   IKPENLLRRSPTNRKLTTGCEILDGCLRGGISCDSLTEIVAESGCGKTQLCLQLSLCTQL 65

Query: 65  PSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSN-------DHNPCDYIFVQSVHSVD 117
           P SHGGL+ SSLYLH+EFPFP RRLHQLSHTF  SN       + NPCD++FVQ+VHSVD
Sbjct: 66  PISHGGLNGSSLYLHSEFPFPFRRLHQLSHTFHQSNPSIYANYNDNPCDHVFVQNVHSVD 125

Query: 118 QLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGML 177
            L DIMP+I+ F+ NS  +R P++LIV+DS+AALFRS+FDNT  DLKKRS LFFKISG L
Sbjct: 126 HLFDIMPRIDGFVGNS-KTRFPLKLIVLDSVAALFRSEFDNTPSDLKKRSSLFFKISGKL 184

Query: 178 KAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSR 237
           K +A  F LA+++TNQV DL+E ++G++GLR+GNL  LYSSGR + P+LG+AWANCVNSR
Sbjct: 185 KQLASKFDLAIVITNQVTDLVETSDGLSGLRIGNLRYLYSSGRRVVPSLGLAWANCVNSR 244

Query: 238 LFLSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGV 297
            F+SR++  +V++    +     S     V R  +R L +VF+P+L  +SCEF ITREG+
Sbjct: 245 FFISRSDGSIVKDRSEKDENCSSS-----VSRSAKRRLDIVFSPYLPGSSCEFMITREGI 299

Query: 298 FGVE 301
             V+
Sbjct: 300 CAVQ 303




Plays essential roles in DNA damage repair in both somatic and meiotic cells. It is important for postsynaptic events following pachytene in meiosis. It is also required for DNA cross-links repair and is involved in double strand breaks (DSBs) repair.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9CXE6|XRCC3_MOUSE DNA repair protein XRCC3 OS=Mus musculus GN=Xrcc3 PE=2 SV=1 Back     alignment and function description
>sp|O43542|XRCC3_HUMAN DNA repair protein XRCC3 OS=Homo sapiens GN=XRCC3 PE=1 SV=1 Back     alignment and function description
>sp|Q08DH8|XRCC3_BOVIN DNA repair protein XRCC3 OS=Bos taurus GN=XRCC3 PE=2 SV=1 Back     alignment and function description
>sp|O35719|RA51B_MOUSE DNA repair protein RAD51 homolog 2 OS=Mus musculus GN=Rad51b PE=2 SV=2 Back     alignment and function description
>sp|B1YC14|RADA_PYRNV DNA repair and recombination protein RadA OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=radA PE=3 SV=1 Back     alignment and function description
>sp|P0CW91|RADA_AERPX DNA repair and recombination protein RadA OS=Aeropyrum pernix GN=radA PE=3 SV=1 Back     alignment and function description
>sp|P0CW92|RADA_AERPE DNA repair and recombination protein RadA OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=radA PE=3 SV=1 Back     alignment and function description
>sp|A3MXX9|RADA_PYRCJ DNA repair and recombination protein RadA OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=radA PE=3 SV=1 Back     alignment and function description
>sp|Q8ZYR9|RADA_PYRAE DNA repair and recombination protein RadA OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=radA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
225446054300 PREDICTED: DNA repair protein XRCC3 homo 0.966 0.973 0.656 1e-108
147777505 2077 hypothetical protein VITISV_027869 [Viti 0.966 0.140 0.656 1e-108
255581709301 X-ray repair cross complementing protein 0.943 0.946 0.637 1e-105
449466133294 PREDICTED: DNA repair protein XRCC3 homo 0.960 0.986 0.665 1e-104
224142257290 predicted protein [Populus trichocarpa] 0.940 0.979 0.625 1e-102
297735394260 unnamed protein product [Vitis vinifera] 0.854 0.992 0.63 1e-97
15242137304 DNA repair protein XRCC3-like protein [A 0.963 0.957 0.582 1e-96
356567224288 PREDICTED: DNA repair protein XRCC3 homo 0.900 0.944 0.562 6e-86
242065454292 hypothetical protein SORBIDRAFT_04g02309 0.870 0.900 0.473 1e-51
413937284291 hypothetical protein ZEAMMB73_748424 [Ze 0.824 0.855 0.477 1e-46
>gi|225446054|ref|XP_002268968.1| PREDICTED: DNA repair protein XRCC3 homolog [Vitis vinifera] Back     alignment and taxonomy information
 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/306 (65%), Positives = 239/306 (78%), Gaps = 14/306 (4%)

Query: 5   MTPQNLLDNPL--TTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSA 62
           M PQNLL NPL  TT+KCT+GCPI+DRCL GG+PCNSITELVAESGSGKTQ CLQL LSA
Sbjct: 1   MIPQNLLQNPLALTTQKCTLGCPILDRCLAGGVPCNSITELVAESGSGKTQLCLQLVLSA 60

Query: 63  QLPSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDH------NPCDYIFVQSVHSV 116
           QLP+S GGL+ASSLY+H+EFPFP RRL QLS +FR S  H      NP D++ V+ V S 
Sbjct: 61  QLPTSLGGLAASSLYIHSEFPFPSRRLQQLSQSFRSSYSHVLDSEYNPLDFVLVRGVQSA 120

Query: 117 DQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGM 176
           DQL D++ K++S +     ++LP+RLIVIDSIAALFR +F+NT  DLK+RS LFFKISG 
Sbjct: 121 DQLFDVLLKMDSVLLRPP-TQLPVRLIVIDSIAALFRGEFENTPFDLKRRSSLFFKISGK 179

Query: 177 LKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNS 236
           LKA+A  FGLAV+VTNQVVD +    G+NGLRVGNLG L+SSGR +C ALG++WANCVNS
Sbjct: 180 LKALAERFGLAVVVTNQVVDFVGQAGGLNGLRVGNLGSLWSSGRRVCAALGLSWANCVNS 239

Query: 237 RLFLSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREG 296
           RLFLSRNE+ V         G+GG G+ D V R TRR LHV+FAPHL ++SCEF I+REG
Sbjct: 240 RLFLSRNEEIVGEVT-----GLGGVGAGDTVSRLTRRHLHVIFAPHLPESSCEFVISREG 294

Query: 297 VFGVER 302
           V GVER
Sbjct: 295 VLGVER 300




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147777505|emb|CAN60498.1| hypothetical protein VITISV_027869 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255581709|ref|XP_002531657.1| X-ray repair cross complementing protein 3, xrcc3, putative [Ricinus communis] gi|223528715|gb|EEF30727.1| X-ray repair cross complementing protein 3, xrcc3, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449466133|ref|XP_004150781.1| PREDICTED: DNA repair protein XRCC3 homolog [Cucumis sativus] gi|449506730|ref|XP_004162832.1| PREDICTED: DNA repair protein XRCC3 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|224142257|ref|XP_002324475.1| predicted protein [Populus trichocarpa] gi|222865909|gb|EEF03040.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297735394|emb|CBI17834.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15242137|ref|NP_200554.1| DNA repair protein XRCC3-like protein [Arabidopsis thaliana] gi|30696870|ref|NP_851202.1| DNA repair protein XRCC3-like protein [Arabidopsis thaliana] gi|55583983|sp|Q9FKM5.1|XRCC3_ARATH RecName: Full=DNA repair protein XRCC3 homolog; AltName: Full=X-ray repair cross-complementing protein 3 homolog; Short=AtXRCC3 gi|9758307|dbj|BAB08781.1| unnamed protein product [Arabidopsis thaliana] gi|15425729|dbj|BAB64342.1| AtXRCC3alpha [Arabidopsis thaliana] gi|16444953|dbj|BAB70684.1| AtXRCC3beta [Arabidopsis thaliana] gi|19571703|emb|CAD27641.1| Rad51B protein [Arabidopsis thaliana] gi|19571705|emb|CAD27642.1| Rad51B protein [Arabidopsis thaliana] gi|20384750|gb|AAK54457.1| DNA repair protein XRCC3 [Arabidopsis thaliana] gi|109946499|gb|ABG48428.1| At5g57450 [Arabidopsis thaliana] gi|332009520|gb|AED96903.1| DNA repair protein XRCC3-like protein [Arabidopsis thaliana] gi|332009521|gb|AED96904.1| DNA repair protein XRCC3-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356567224|ref|XP_003551821.1| PREDICTED: DNA repair protein XRCC3 homolog [Glycine max] Back     alignment and taxonomy information
>gi|242065454|ref|XP_002454016.1| hypothetical protein SORBIDRAFT_04g023090 [Sorghum bicolor] gi|241933847|gb|EES06992.1| hypothetical protein SORBIDRAFT_04g023090 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|413937284|gb|AFW71835.1| hypothetical protein ZEAMMB73_748424 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
TAIR|locus:2174577304 XRCC3 "homolog of X-ray repair 0.956 0.950 0.586 1.7e-91
DICTYBASE|DDB_G0283637 564 xrcc3 "putative DNA repair pro 0.324 0.173 0.474 5.8e-38
UNIPROTKB|O43542346 XRCC3 "DNA repair protein XRCC 0.715 0.624 0.369 4.4e-34
UNIPROTKB|F1S9W9347 XRCC3 "Uncharacterized protein 0.698 0.608 0.355 4.4e-34
UNIPROTKB|E2RAE7349 XRCC3 "Uncharacterized protein 0.711 0.616 0.351 4.4e-34
UNIPROTKB|Q08DH8341 XRCC3 "DNA repair protein XRCC 0.695 0.615 0.359 1.1e-33
UNIPROTKB|Q5ZM26347 XRCC3 "Uncharacterized protein 0.854 0.743 0.353 4.2e-31
ZFIN|ZDB-GENE-050320-116352 xrcc3 "X-ray repair complement 0.692 0.593 0.378 8.8e-31
MGI|MGI:1921585349 Xrcc3 "X-ray repair complement 0.731 0.633 0.356 1.2e-28
RGD|1306849349 Xrcc3 "X-ray repair complement 0.731 0.633 0.340 1.3e-27
TAIR|locus:2174577 XRCC3 "homolog of X-ray repair cross complementing 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 912 (326.1 bits), Expect = 1.7e-91, P = 1.7e-91
 Identities = 177/302 (58%), Positives = 225/302 (74%)

Query:     7 PQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPS 66
             P+NLL    T  K T GC I+D CL GGI C+S+TE+VAESG GKTQ CLQL+L  QLP 
Sbjct:     8 PENLLRRSPTNRKLTTGCEILDGCLRGGISCDSLTEIVAESGCGKTQLCLQLSLCTQLPI 67

Query:    67 SHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSN-------DHNPCDYIFVQSVHSVDQL 119
             SHGGL+ SSLYLH+EFPFP RRLHQLSHTF  SN       + NPCD++FVQ+VHSVD L
Sbjct:    68 SHGGLNGSSLYLHSEFPFPFRRLHQLSHTFHQSNPSIYANYNDNPCDHVFVQNVHSVDHL 127

Query:   120 LDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKA 179
              DIMP+I+ F+ NS  +R P++LIV+DS+AALFRS+FDNT  DLKKRS LFFKISG LK 
Sbjct:   128 FDIMPRIDGFVGNSK-TRFPLKLIVLDSVAALFRSEFDNTPSDLKKRSSLFFKISGKLKQ 186

Query:   180 MAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLF 239
             +A  F LA+++TNQV DL+E ++G++GLR+GNL  LYSSGR + P+LG+AWANCVNSR F
Sbjct:   187 LASKFDLAIVITNQVTDLVETSDGLSGLRIGNLRYLYSSGRRVVPSLGLAWANCVNSRFF 246

Query:   240 LSRNEDFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFG 299
             +SR++  +V++    +     S     V R  +R L +VF+P+L  +SCEF ITREG+  
Sbjct:   247 ISRSDGSIVKDRSEKDENCSSS-----VSRSAKRRLDIVFSPYLPGSSCEFMITREGICA 301

Query:   300 VE 301
             V+
Sbjct:   302 VQ 303




GO:0003677 "DNA binding" evidence=IEA
GO:0003684 "damaged DNA binding" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006281 "DNA repair" evidence=ISS
GO:0008094 "DNA-dependent ATPase activity" evidence=IEA
GO:0003697 "single-stranded DNA binding" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
GO:0006302 "double-strand break repair" evidence=RCA;IMP
GO:0007126 "meiosis" evidence=IMP
GO:0000724 "double-strand break repair via homologous recombination" evidence=RCA
GO:0006312 "mitotic recombination" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0007062 "sister chromatid cohesion" evidence=RCA
GO:0007129 "synapsis" evidence=RCA
GO:0007131 "reciprocal meiotic recombination" evidence=RCA
GO:0010212 "response to ionizing radiation" evidence=RCA
GO:0042138 "meiotic DNA double-strand break formation" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045132 "meiotic chromosome segregation" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0045003 "double-strand break repair via synthesis-dependent strand annealing" evidence=IDA
DICTYBASE|DDB_G0283637 xrcc3 "putative DNA repair protein XRCC3" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|O43542 XRCC3 "DNA repair protein XRCC3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9W9 XRCC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAE7 XRCC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DH8 XRCC3 "DNA repair protein XRCC3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM26 XRCC3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050320-116 xrcc3 "X-ray repair complementing defective repair in Chinese hamster cells 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1921585 Xrcc3 "X-ray repair complementing defective repair in Chinese hamster cells 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306849 Xrcc3 "X-ray repair complementing defective repair in Chinese hamster cells 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FKM5XRCC3_ARATHNo assigned EC number0.58220.96350.9572yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
cd01123235 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B 4e-79
cd01393226 cd01393, recA_like, RecA is a bacterial enzyme whi 1e-64
TIGR02236310 TIGR02236, recomb_radA, DNA repair and recombinati 2e-29
PRK04301317 PRK04301, radA, DNA repair and recombination prote 3e-29
PLN03186342 PLN03186, PLN03186, DNA repair protein RAD51 homol 1e-27
COG0468279 COG0468, RecA, RecA/RadA recombinase [DNA replicat 2e-26
PTZ00035337 PTZ00035, PTZ00035, Rad51 protein; Provisional 2e-26
PLN03187344 PLN03187, PLN03187, meiotic recombination protein 5e-24
pfam08423261 pfam08423, Rad51, Rad51 1e-23
TIGR02239316 TIGR02239, recomb_RAD51, DNA repair protein RAD51 8e-23
TIGR02238313 TIGR02238, recomb_DMC1, meiotic recombinase Dmc1 2e-22
PRK09361225 PRK09361, radB, DNA repair and recombination prote 8e-20
TIGR02237209 TIGR02237, recomb_radB, DNA repair and recombinati 1e-16
cd01394218 cd01394, radB, RadB 4e-16
COG0467260 COG0467, RAD55, RecA-superfamily ATPases implicate 3e-06
pfam06745231 pfam06745, KaiC, KaiC 2e-05
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 2e-05
cd00983325 cd00983, recA, RecA is a bacterial enzyme which ha 4e-05
COG2874235 COG2874, FlaH, Predicted ATPases involved in bioge 2e-04
PRK08533230 PRK08533, PRK08533, flagellar accessory protein Fl 5e-04
TIGR03881229 TIGR03881, KaiC_arch_4, KaiC domain protein, PAE11 0.003
>gnl|CDD|238543 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B Back     alignment and domain information
 Score =  239 bits (613), Expect = 4e-79
 Identities = 89/277 (32%), Positives = 131/277 (47%), Gaps = 44/277 (15%)

Query: 21  TVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHT 80
           T G   +D  LGGGI   SITE+  E GSGKTQ C QL ++ QLP   GGL   ++Y+ T
Sbjct: 2   TTGSKALDELLGGGIETGSITEIFGEFGSGKTQLCHQLAVTVQLPIELGGLEGKAVYIDT 61

Query: 81  EFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPI 140
           E  F   RL Q++  F    +    D I+V   ++ D  L ++ ++E+ +  SS     I
Sbjct: 62  EGTFRPERLVQIAERFGLDPE-EVLDNIYVARAYNSDHQLQLLEELEAILIESSR----I 116

Query: 141 RLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEP 200
           +L+++DS+ ALFR++FD    +L +R     K+   LK +A  F +AV++TNQV    + 
Sbjct: 117 KLVIVDSVTALFRAEFDG-RGELAERQQHLAKLLRTLKRLADEFNVAVVITNQVTARPD- 174

Query: 201 NEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVVRENQMVNGGVGG 260
                       G     G P  PA G  WA+   +RL+L +                  
Sbjct: 175 ------------GAAMFGGDPKKPAGGNIWAHASTTRLYLRKG----------------- 205

Query: 261 SGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGV 297
                   R   R   +V +PHL +    F IT EG+
Sbjct: 206 --------RGEERIAKIVDSPHLPEGEAVFAITEEGI 234


This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 . Length = 235

>gnl|CDD|238687 cd01393, recA_like, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>gnl|CDD|131290 TIGR02236, recomb_radA, DNA repair and recombination protein RadA Back     alignment and domain information
>gnl|CDD|235273 PRK04301, radA, DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>gnl|CDD|178728 PLN03186, PLN03186, DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>gnl|CDD|223544 COG0468, RecA, RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|185407 PTZ00035, PTZ00035, Rad51 protein; Provisional Back     alignment and domain information
>gnl|CDD|215620 PLN03187, PLN03187, meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>gnl|CDD|117002 pfam08423, Rad51, Rad51 Back     alignment and domain information
>gnl|CDD|233794 TIGR02239, recomb_RAD51, DNA repair protein RAD51 Back     alignment and domain information
>gnl|CDD|131292 TIGR02238, recomb_DMC1, meiotic recombinase Dmc1 Back     alignment and domain information
>gnl|CDD|236482 PRK09361, radB, DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>gnl|CDD|233793 TIGR02237, recomb_radB, DNA repair and recombination protein RadB Back     alignment and domain information
>gnl|CDD|238688 cd01394, radB, RadB Back     alignment and domain information
>gnl|CDD|223543 COG0467, RAD55, RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|219158 pfam06745, KaiC, KaiC Back     alignment and domain information
>gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|238483 cd00983, recA, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>gnl|CDD|225429 COG2874, FlaH, Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|181459 PRK08533, PRK08533, flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>gnl|CDD|163593 TIGR03881, KaiC_arch_4, KaiC domain protein, PAE1156 family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 302
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 100.0
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 100.0
KOG1564351 consensus DNA repair protein RHP57 [Replication, r 100.0
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 100.0
KOG1434335 consensus Meiotic recombination protein Dmc1 [Cell 100.0
PLN03186342 DNA repair protein RAD51 homolog; Provisional 100.0
PTZ00035337 Rad51 protein; Provisional 100.0
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 100.0
PRK04301317 radA DNA repair and recombination protein RadA; Va 100.0
TIGR02236310 recomb_radA DNA repair and recombination protein R 100.0
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 100.0
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 100.0
cd01393226 recA_like RecA is a bacterial enzyme which has rol 100.0
PRK09361225 radB DNA repair and recombination protein RadB; Pr 100.0
cd01394218 radB RadB. The archaeal protein radB shares simila 100.0
TIGR02237209 recomb_radB DNA repair and recombination protein R 100.0
cd00983325 recA RecA is a bacterial enzyme which has roles in 100.0
PRK09354349 recA recombinase A; Provisional 100.0
TIGR02012321 tigrfam_recA protein RecA. This model describes or 100.0
PRK09519 790 recA DNA recombination protein RecA; Reviewed 100.0
PF00154322 RecA: recA bacterial DNA recombination protein; In 99.97
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 99.96
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 99.96
PRK11823 446 DNA repair protein RadA; Provisional 99.96
KOG1433326 consensus DNA repair protein RAD51/RHP55 [Replicat 99.95
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 99.95
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 99.95
PRK04328249 hypothetical protein; Provisional 99.95
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 99.95
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 99.94
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 99.91
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 99.91
PRK09302509 circadian clock protein KaiC; Reviewed 99.91
PRK06067234 flagellar accessory protein FlaH; Validated 99.9
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 99.9
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 99.89
PRK09302 509 circadian clock protein KaiC; Reviewed 99.89
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 99.87
PRK08533230 flagellar accessory protein FlaH; Reviewed 99.82
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 99.8
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 99.79
TIGR00665434 DnaB replicative DNA helicase. This model describe 99.78
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 99.77
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 99.77
KOG2859293 consensus DNA repair protein, member of the recA/R 99.76
PRK08760476 replicative DNA helicase; Provisional 99.76
PRK05748448 replicative DNA helicase; Provisional 99.76
PRK06321472 replicative DNA helicase; Provisional 99.74
PHA02542473 41 41 helicase; Provisional 99.74
PRK05595444 replicative DNA helicase; Provisional 99.74
PRK05636505 replicative DNA helicase; Provisional 99.73
PRK09165497 replicative DNA helicase; Provisional 99.73
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 99.72
PRK07004460 replicative DNA helicase; Provisional 99.72
PRK08006471 replicative DNA helicase; Provisional 99.72
PRK06904472 replicative DNA helicase; Validated 99.71
PRK08506472 replicative DNA helicase; Provisional 99.71
PRK05973237 replicative DNA helicase; Provisional 99.71
PRK08840464 replicative DNA helicase; Provisional 99.71
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 99.69
PRK06749428 replicative DNA helicase; Provisional 99.66
PRK07773 886 replicative DNA helicase; Validated 99.63
cd01124187 KaiC KaiC is a circadian clock protein primarily f 99.6
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 99.58
COG0305435 DnaB Replicative DNA helicase [DNA replication, re 99.54
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 99.48
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 99.31
COG1127263 Ttg2A ABC-type transport system involved in resist 99.07
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.0
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 99.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 98.93
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.92
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 98.91
COG1136226 SalX ABC-type antimicrobial peptide transport syst 98.9
COG1126240 GlnQ ABC-type polar amino acid transport system, A 98.89
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 98.89
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 98.88
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.86
COG3638258 ABC-type phosphate/phosphonate transport system, A 98.82
PF13479213 AAA_24: AAA domain 98.81
COG4619223 ABC-type uncharacterized transport system, ATPase 98.8
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.8
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 98.8
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 98.77
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 98.77
COG0411250 LivG ABC-type branched-chain amino acid transport 98.76
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 98.74
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 98.73
COG0410237 LivF ABC-type branched-chain amino acid transport 98.72
COG2884223 FtsE Predicted ATPase involved in cell division [C 98.7
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 98.68
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 98.68
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 98.67
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.67
COG3845 501 ABC-type uncharacterized transport systems, ATPase 98.66
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 98.65
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 98.63
smart00382148 AAA ATPases associated with a variety of cellular 98.63
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 98.62
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 98.62
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.59
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 98.59
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 98.58
COG4175386 ProV ABC-type proline/glycine betaine transport sy 98.56
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 98.55
cd03246173 ABCC_Protease_Secretion This family represents the 98.55
COG1123539 ATPase components of various ABC-type transport sy 98.53
COG4586325 ABC-type uncharacterized transport system, ATPase 98.53
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.51
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 98.51
PRK04296190 thymidine kinase; Provisional 98.51
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 98.5
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 98.5
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 98.5
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 98.5
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 98.5
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.49
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 98.48
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 98.48
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 98.48
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 98.48
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 98.47
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 98.47
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 98.46
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 98.46
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 98.46
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 98.45
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 98.45
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 98.45
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 98.45
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 98.44
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 98.44
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 98.44
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 98.44
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 98.44
COG4172534 ABC-type uncharacterized transport system, duplica 98.44
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 98.44
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 98.43
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 98.43
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 98.43
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 98.43
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 98.42
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 98.42
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 98.42
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 98.42
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 98.42
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 98.41
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 98.41
cd03215182 ABC_Carb_Monos_II This family represents domain II 98.41
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 98.4
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 98.4
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 98.4
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 98.4
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 98.4
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 98.4
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 98.39
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 98.39
PRK11153343 metN DL-methionine transporter ATP-binding subunit 98.39
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 98.39
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 98.38
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 98.38
cd03115173 SRP The signal recognition particle (SRP) mediates 98.38
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 98.38
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 98.37
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 98.37
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 98.37
PRK13537306 nodulation ABC transporter NodI; Provisional 98.37
PF00004132 AAA: ATPase family associated with various cellula 98.37
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 98.37
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 98.37
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 98.36
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 98.36
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 98.36
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 98.36
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 98.36
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 98.36
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 98.36
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 98.36
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 98.35
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 98.35
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 98.35
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 98.35
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 98.35
PRK09473330 oppD oligopeptide transporter ATP-binding componen 98.35
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 98.35
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 98.34
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 98.34
COG1123 539 ATPase components of various ABC-type transport sy 98.34
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 98.34
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.34
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 98.33
COG4181228 Predicted ABC-type transport system involved in ly 98.33
cd03299235 ABC_ModC_like Archeal protein closely related to M 98.33
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 98.33
cd03269210 ABC_putative_ATPase This subfamily is involved in 98.33
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 98.33
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.33
PRK10908222 cell division protein FtsE; Provisional 98.32
COG1117253 PstB ABC-type phosphate transport system, ATPase c 98.32
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 98.32
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 98.32
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 98.32
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 98.32
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 98.32
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 98.31
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 98.31
COG4172 534 ABC-type uncharacterized transport system, duplica 98.31
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 98.31
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 98.31
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 98.31
PRK09984262 phosphonate/organophosphate ester transporter subu 98.31
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 98.3
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 98.3
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 98.3
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 98.3
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 98.3
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 98.3
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 98.3
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 98.3
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 98.3
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 98.29
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 98.29
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.29
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 98.28
PRK13536340 nodulation factor exporter subunit NodI; Provision 98.28
PRK11607377 potG putrescine transporter ATP-binding subunit; P 98.28
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 98.28
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 98.27
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 98.27
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 98.27
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 98.27
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.27
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 98.26
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 98.26
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 98.26
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 98.26
PRK10261 623 glutathione transporter ATP-binding protein; Provi 98.26
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 98.26
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 98.25
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 98.25
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 98.24
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 98.24
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 98.24
PRK10790592 putative multidrug transporter membrane\ATP-bindin 98.24
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 98.24
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 98.24
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 98.24
PRK10253265 iron-enterobactin transporter ATP-binding protein; 98.24
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 98.23
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 98.23
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 98.23
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 98.22
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 98.22
PRK07721438 fliI flagellum-specific ATP synthase; Validated 98.22
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 98.22
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 98.22
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 98.21
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 98.21
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 98.21
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 98.21
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 98.21
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 98.21
PRK10938 490 putative molybdenum transport ATP-binding protein 98.21
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 98.2
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 98.2
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 98.2
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 98.19
COG4615546 PvdE ABC-type siderophore export system, fused ATP 98.19
PRK09099441 type III secretion system ATPase; Provisional 98.19
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 98.19
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 98.18
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 98.18
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 98.17
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 98.17
PRK13409590 putative ATPase RIL; Provisional 98.16
TIGR02546422 III_secr_ATP type III secretion apparatus H+-trans 98.16
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 98.16
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 98.16
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 98.16
COG4167267 SapF ABC-type antimicrobial peptide transport syst 98.16
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 98.15
COG2087175 CobU Adenosyl cobinamide kinase/adenosyl cobinamid 98.15
PF13173128 AAA_14: AAA domain 98.15
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 98.15
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 98.15
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 98.15
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 98.14
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 98.14
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 98.14
COG4559259 ABC-type hemin transport system, ATPase component 98.14
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 98.13
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 98.13
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 98.13
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 98.12
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 98.12
PRK07594433 type III secretion system ATPase SsaN; Validated 98.12
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 98.12
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 98.12
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 98.12
PRK10416318 signal recognition particle-docking protein FtsY; 98.11
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 98.11
PRK10619257 histidine/lysine/arginine/ornithine transporter su 98.11
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 98.11
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 98.11
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 98.1
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 98.1
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 98.1
PRK10261623 glutathione transporter ATP-binding protein; Provi 98.1
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 98.1
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 98.1
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 98.09
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 98.09
PRK10789569 putative multidrug transporter membrane\ATP-bindin 98.09
PRK13546264 teichoic acids export protein ATP-binding subunit; 98.09
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 98.09
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 98.09
PRK05688451 fliI flagellum-specific ATP synthase; Validated 98.09
COG4152300 ABC-type uncharacterized transport system, ATPase 98.08
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 98.08
TIGR00064272 ftsY signal recognition particle-docking protein F 98.08
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 98.08
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 98.08
PRK07165 507 F0F1 ATP synthase subunit alpha; Validated 98.08
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 98.07
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 98.07
CHL00059485 atpA ATP synthase CF1 alpha subunit 98.07
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 98.07
PRK06936439 type III secretion system ATPase; Provisional 98.07
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.06
PRK06793432 fliI flagellum-specific ATP synthase; Validated 98.06
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.06
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 98.06
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 98.06
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 98.06
TIGR00962501 atpA proton translocating ATP synthase, F1 alpha s 98.05
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 98.05
PRK09580248 sufC cysteine desulfurase ATPase component; Review 98.04
PRK09700510 D-allose transporter ATP-binding protein; Provisio 98.04
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 98.04
PRK03695248 vitamin B12-transporter ATPase; Provisional 98.04
PRK10867433 signal recognition particle protein; Provisional 98.04
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 98.04
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 98.04
COG4148352 ModC ABC-type molybdate transport system, ATPase c 98.03
COG4598256 HisP ABC-type histidine transport system, ATPase c 98.03
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 98.03
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 98.03
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 98.02
PRK08972444 fliI flagellum-specific ATP synthase; Validated 98.02
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 98.02
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 98.01
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.01
PRK05922434 type III secretion system ATPase; Validated 98.01
COG4618580 ArpD ABC-type protease/lipase transport system, AT 98.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 98.0
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 98.0
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 98.0
PLN032321495 ABC transporter C family member; Provisional 98.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 98.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 98.0
PRK08181269 transposase; Validated 97.99
PLN031301622 ABC transporter C family member; Provisional 97.98
PRK06002450 fliI flagellum-specific ATP synthase; Validated 97.98
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.98
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 97.98
COG4988559 CydD ABC-type transport system involved in cytochr 97.98
PRK08927442 fliI flagellum-specific ATP synthase; Validated 97.98
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 97.97
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 97.97
PRK12377248 putative replication protein; Provisional 97.96
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.96
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 97.96
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 97.96
PF02283167 CobU: Cobinamide kinase / cobinamide phosphate gua 97.96
cd03234226 ABCG_White The White subfamily represents ABC tran 97.96
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 97.96
PRK08472434 fliI flagellum-specific ATP synthase; Validated 97.95
PRK06835329 DNA replication protein DnaC; Validated 97.95
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 97.94
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 97.94
PRK13409 590 putative ATPase RIL; Provisional 97.94
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.94
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 97.93
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.93
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 97.93
PRK08084235 DNA replication initiation factor; Provisional 97.93
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 97.93
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 97.92
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 97.92
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 97.92
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 97.92
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. 97.9
PRK08149428 ATP synthase SpaL; Validated 97.9
PRK06921266 hypothetical protein; Provisional 97.9
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.89
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 97.89
PRK11288501 araG L-arabinose transporter ATP-binding protein; 97.89
COG4987573 CydC ABC-type transport system involved in cytochr 97.89
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 97.89
PRK14974336 cell division protein FtsY; Provisional 97.88
PTZ002431560 ABC transporter; Provisional 97.88
PRK07196434 fliI flagellum-specific ATP synthase; Validated 97.88
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 97.87
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.87
PRK10522547 multidrug transporter membrane component/ATP-bindi 97.86
PRK09280463 F0F1 ATP synthase subunit beta; Validated 97.86
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.86
PRK08116268 hypothetical protein; Validated 97.86
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. 97.86
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.85
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.85
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 97.85
PRK07960455 fliI flagellum-specific ATP synthase; Validated 97.85
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 97.84
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 97.84
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 97.84
PRK09376416 rho transcription termination factor Rho; Provisio 97.84
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 97.84
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 97.84
PRK15064 530 ABC transporter ATP-binding protein; Provisional 97.83
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 97.83
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 97.83
PRK06526254 transposase; Provisional 97.82
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 97.81
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.81
cd01128249 rho_factor Transcription termination factor rho is 97.81
PRK12608380 transcription termination factor Rho; Provisional 97.81
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.81
TIGR01042 591 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th 97.81
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.81
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 97.81
PRK06820440 type III secretion system ATPase; Validated 97.81
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 97.8
PRK10762501 D-ribose transporter ATP binding protein; Provisio 97.8
PRK06893229 DNA replication initiation factor; Validated 97.8
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.8
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 97.79
PLN03211 659 ABC transporter G-25; Provisional 97.79
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.79
PRK10938490 putative molybdenum transport ATP-binding protein 97.79
PRK08727233 hypothetical protein; Validated 97.79
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 97.79
PRK04196460 V-type ATP synthase subunit B; Provisional 97.78
PRK00771437 signal recognition particle protein Srp54; Provisi 97.78
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.78
CHL00060494 atpB ATP synthase CF1 beta subunit 97.78
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 97.77
PRK03992389 proteasome-activating nucleotidase; Provisional 97.77
PF05729166 NACHT: NACHT domain 97.77
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 97.76
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 97.76
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 97.76
COG1101263 PhnK ABC-type uncharacterized transport system, AT 97.76
PTZ00185 574 ATPase alpha subunit; Provisional 97.76
PRK07952244 DNA replication protein DnaC; Validated 97.75
PRK05642234 DNA replication initiation factor; Validated 97.75
COG0488530 Uup ATPase components of ABC transporters with dup 97.75
TIGR01043578 ATP_syn_A_arch ATP synthase archaeal, A subunit. A 97.75
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 97.75
PRK04192586 V-type ATP synthase subunit A; Provisional 97.75
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 97.74
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.74
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 97.74
CHL00176 638 ftsH cell division protein; Validated 97.73
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 97.73
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 97.73
COG4136213 ABC-type uncharacterized transport system, ATPase 97.73
TIGR00959428 ffh signal recognition particle protein. This mode 97.72
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 97.71
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 97.71
PLN03140 1470 ABC transporter G family member; Provisional 97.71
COG1119257 ModF ABC-type molybdenum transport system, ATPase 97.7
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 97.7
PLN03073 718 ABC transporter F family; Provisional 97.7
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 97.69
TIGR00767415 rho transcription termination factor Rho. Members 97.69
COG4178604 ABC-type uncharacterized transport system, permeas 97.69
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 97.68
PLN03232 1495 ABC transporter C family member; Provisional 97.68
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 97.67
PRK11147635 ABC transporter ATPase component; Reviewed 97.67
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 97.67
PRK10535 648 macrolide transporter ATP-binding /permease protei 97.66
CHL00195489 ycf46 Ycf46; Provisional 97.66
KOG0736953 consensus Peroxisome assembly factor 2 containing 97.66
COG4133209 CcmA ABC-type transport system involved in cytochr 97.66
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 97.66
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 97.66
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.65
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 97.65
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 97.64
COG1157441 FliI Flagellar biosynthesis/type III secretory pat 97.64
COG0488 530 Uup ATPase components of ABC transporters with dup 97.64
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.64
PRK10636638 putative ABC transporter ATP-binding protein; Prov 97.63
PLN03130 1622 ABC transporter C family member; Provisional 97.61
PRK14088440 dnaA chromosomal replication initiation protein; P 97.61
PF05625363 PAXNEB: PAXNEB protein; InterPro: IPR008728 The RN 97.6
PRK00889175 adenylylsulfate kinase; Provisional 97.6
PRK12678672 transcription termination factor Rho; Provisional 97.6
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
Probab=100.00  E-value=1.2e-53  Score=372.32  Aligned_cols=250  Identities=40%  Similarity=0.709  Sum_probs=213.3

Q ss_pred             ccccccCCCCCCccccCChhhHhhhCCCCCCCcEEEEEeCCCCcHHHHHHHHHHHccCCCcCCCCCCeEEEEeCCCCCCH
Q 022155            7 PQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPM   86 (302)
Q Consensus         7 ~~~l~~~~~~~~~i~tG~~~LD~~L~GGl~~G~i~ei~G~~GsGKT~l~l~la~~~~l~~~~gg~~~~vlyid~e~~~~~   86 (302)
                      ..++++.+.....|+||++.||.+|+|||+.|.+|||+|+||||||+||+++|.++++|...||.+++|+|||||++|++
T Consensus         7 a~~~~~~~~~~~~i~Tg~~~lD~~L~GGi~~g~itEi~G~~gsGKTql~l~l~~~~~l~~~~~g~~~~vvyidTe~~f~~   86 (256)
T PF08423_consen    7 AAELLEQRKRWSRISTGCKSLDELLGGGIPTGSITEIVGESGSGKTQLCLQLAVNVQLPEEIGGLGGKVVYIDTEGTFSP   86 (256)
T ss_dssp             HHHHHHHHHTS-EE--SSHHHHHHTTSSEETTSEEEEEESTTSSHHHHHHHHHHHTTSGGCTTSSSSEEEEEESSSSS-H
T ss_pred             HHHHHHHhhcCCeeCCCCHHHHHhhCCCCCCCcEEEEEEecccccchHHHHHHHHhhcccccccCCCceEEEeCCCCCCH
Confidence            44678888889999999999999999999999999999999999999999999999998777888889999999999999


Q ss_pred             HHHHHHHHHhCCCCCCCCCCcEEEEeCCCHHHHHHHHHHHHHHHHhccCCCCCeeEEEEechhhhhhhccCCChhhHHHH
Q 022155           87 RRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKR  166 (302)
Q Consensus        87 ~rl~~i~~~~~~~~~~~~l~~i~~~~~~~~~~l~~~l~~l~~~l~~~~~~~~~~~lvVIDsi~~~~~~~~~~~~~~~~~r  166 (302)
                      +|+.+|++.+. ..+++.++|+++.++.+.+++.+++..+...+.+     .+++|||||||+++|+.++.+. +++.+|
T Consensus        87 ~Rl~~i~~~~~-~~~~~~l~~I~v~~~~~~~~l~~~L~~l~~~l~~-----~~ikLIVIDSIaalfr~e~~~~-~~~~~R  159 (256)
T PF08423_consen   87 ERLQQIAERFG-LDPEEILDNIFVIRVFDLEELLELLEQLPKLLSE-----SKIKLIVIDSIAALFRSEFSGR-GDLAER  159 (256)
T ss_dssp             HHHHHHHHHTT-S-HHHHHHTEEEEE-SSHHHHHHHHHHHHHHHHH-----SCEEEEEEETSSHHHHHHSGST-TTHHHH
T ss_pred             HHHHHHhhccc-cccchhhhceeeeecCCHHHHHHHHHHHHhhccc-----cceEEEEecchHHHHHHHHccc-hhhHHH
Confidence            99999998764 2334578999999999999999999999888875     5799999999999999887654 256789


Q ss_pred             HHHHHHHHHHHHHHHHHcCcEEEEEecccccCCCCCCCCCccccCCccccCCCCCccccCCchhhhhcceEEEEEEecCc
Q 022155          167 SFLFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDF  246 (302)
Q Consensus       167 ~~~l~~l~~~L~~la~~~~~~viv~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~lG~~w~~~~~~rl~l~~~~~~  246 (302)
                      ++.|.+++..|+++|++|+++||+|||++++++...            .+ .....+|+||.+|+|++++||+|+|.+. 
T Consensus       160 ~~~L~~~~~~L~~lA~~~~iaVvvTNqv~~~~~~~~------------~~-~~~~~~PalG~~w~h~~~~Rl~l~k~~~-  225 (256)
T PF08423_consen  160 QRMLARLARILKRLARKYNIAVVVTNQVTTKIDSNS------------LF-DGDRLKPALGHSWSHAVTTRLFLSKGRG-  225 (256)
T ss_dssp             HHHHHHHHHHHHHHHHHTT-EEEEEEEECSSTT----------------S-STTSEEETTHHHHHHHSSEEEEEEECST-
T ss_pred             HHHHHHHHHHHHHHHHhCCceEEeeceeeecCCccc------------cc-ccccceecCcchhhhhccEEEEEEeCCC-
Confidence            999999999999999999999999999998876431            11 1246899999999999999999998543 


Q ss_pred             hhcccccccCCCCCCCCCCcccccceEEEEEEECCCCCCceeeEEEecCcccccC
Q 022155          247 VVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVE  301 (302)
Q Consensus       247 ~~~~~~~~~g~~~~~~~~~~~~~~~~R~~~v~ks~~~~~~~~~F~I~~~Gi~~~~  301 (302)
                                              ..|.++|.|||..|..++.|.|+++||+|++
T Consensus       226 ------------------------~~R~~~i~ksp~~p~~~~~f~It~~Gi~d~~  256 (256)
T PF08423_consen  226 ------------------------SERVATIVKSPSLPEGSASFQITEDGIRDVK  256 (256)
T ss_dssp             ------------------------TEEEEEEEECSSSSSEEEEEEEETTEEEE--
T ss_pred             ------------------------CeEEEEEeECCCCCCceEEEEEeCCCccCCC
Confidence                                    4899999999999999999999999999974



It is critical for DNA binding []. Rad51 is a homologue of the bacterial RecA protein. Rad51 and RecA share a core ATPase domain.; PDB: 2ZUC_A 2Z43_C 2ZUD_B 2DFL_A 2ZUB_A 2BKE_A 2KZ3_A 2CVH_B 2CVF_B 1SZP_D ....

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>KOG1564 consensus DNA repair protein RHP57 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>KOG1434 consensus Meiotic recombination protein Dmc1 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>KOG1433 consensus DNA repair protein RAD51/RHP55 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>KOG2859 consensus DNA repair protein, member of the recA/RAD51 family [Replication, recombination and repair] Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG2087 CobU Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK07165 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PF02283 CobU: Cobinamide kinase / cobinamide phosphate guanyltransferase; InterPro: IPR003203 This family is composed of a group of bifunctional cobalbumin biosynthesis enzymes which display cobinamide kinase and cobinamide phosphate guanyltransferase activity Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK04192 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF05625 PAXNEB: PAXNEB protein; InterPro: IPR008728 The RNA polymerase II elongator complex is a major histone acetyltransferase component of the RNA polymerase II (RNAPII) holoenzyme and is involved in transcriptional elongation [, ] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
2dfl_A324 Crystal Structure Of Left-Handed Rada Filament Leng 7e-21
1pzn_A349 Rad51 (Rada) Length = 349 1e-20
2bke_A324 Conformational Flexibility Revealed By The Crystal 8e-20
4b2i_A231 Humanised Monomeric Rada In Complex With Indazole L 1e-19
4a6p_A231 Rada C-Terminal Atpase Domain From Pyrococcus Furio 2e-19
1n0w_A243 Crystal Structure Of A Rad51-Brca2 Brc Repeat Compl 2e-14
1v5w_A343 Crystal Structure Of The Human Dmc1 Protein Length 2e-14
3lda_A400 Yeast Rad51 H352y Filament Interface Mutant Length 3e-14
2zjb_A343 Crystal Structure Of The Human Dmc1-M200v Polymorph 3e-14
1szp_A321 A Crystal Structure Of The Rad51 Filament Length = 4e-14
1t4g_A322 Atpase In Complex With Amp-pnp Length = 322 7e-13
3ntu_A319 Rada Recombinase D302k Mutant In Complex With Amp-P 8e-13
2gdj_A264 Delta-62 Rada Recombinase In Complex With Amp-Pnp A 9e-13
4dc9_A266 Hexameric Ring Of Methanococcus Voltae Rada Length 9e-13
2f1h_A322 Recombinase In Complex With Amp-pnp And Potassium L 2e-12
3etl_A322 Rada Recombinase From Methanococcus Maripaludis In 5e-12
2cvf_A220 Crystal Structure Of The Radb Recombinase Length = 8e-04
>pdb|2DFL|A Chain A, Crystal Structure Of Left-Handed Rada Filament Length = 324 Back     alignment and structure

Iteration: 1

Score = 97.8 bits (242), Expect = 7e-21, Method: Compositional matrix adjust. Identities = 74/287 (25%), Positives = 126/287 (43%), Gaps = 47/287 (16%) Query: 15 LTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSAS 74 + +K + G +D L GGI ++TE E GSGKTQ C QL+++ QLP GGLS Sbjct: 84 MNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGK 143 Query: 75 SLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSS 134 ++Y+ TE F R+ ++ D+ + +++++++ D + I+ ++ + Sbjct: 144 AVYIDTEGTFRWERIENMAKALGLDIDNVMNNIYYIRAINT-DHQIAIVDDLQELVSKDP 202 Query: 135 NSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFGLAVLVTNQV 194 + I+LIV+DS+ + FR+++ ++L R K L +A + +AV++TNQV Sbjct: 203 S----IKLIVVDSVTSHFRAEYPGR-ENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQV 257 Query: 195 VDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVVRENQMV 254 + P+ Y G P G + R+ L + Sbjct: 258 --MARPD------------MFY--GDPTVAVGGHTLYHVPGIRIQLKK------------ 289 Query: 255 NGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVE 301 R RR VV APHL + F +T EG+ E Sbjct: 290 -------------SRGNRRIARVVDAPHLPEGEVVFALTEEGIRDAE 323
>pdb|1PZN|A Chain A, Rad51 (Rada) Length = 349 Back     alignment and structure
>pdb|2BKE|A Chain A, Conformational Flexibility Revealed By The Crystal Structure Of A Crenarchaeal Rada Length = 324 Back     alignment and structure
>pdb|4B2I|A Chain A, Humanised Monomeric Rada In Complex With Indazole Length = 231 Back     alignment and structure
>pdb|4A6P|A Chain A, Rada C-Terminal Atpase Domain From Pyrococcus Furiosus Length = 231 Back     alignment and structure
>pdb|1N0W|A Chain A, Crystal Structure Of A Rad51-Brca2 Brc Repeat Complex Length = 243 Back     alignment and structure
>pdb|1V5W|A Chain A, Crystal Structure Of The Human Dmc1 Protein Length = 343 Back     alignment and structure
>pdb|3LDA|A Chain A, Yeast Rad51 H352y Filament Interface Mutant Length = 400 Back     alignment and structure
>pdb|2ZJB|A Chain A, Crystal Structure Of The Human Dmc1-M200v Polymorphic Variant Length = 343 Back     alignment and structure
>pdb|1SZP|A Chain A, A Crystal Structure Of The Rad51 Filament Length = 321 Back     alignment and structure
>pdb|1T4G|A Chain A, Atpase In Complex With Amp-pnp Length = 322 Back     alignment and structure
>pdb|3NTU|A Chain A, Rada Recombinase D302k Mutant In Complex With Amp-Pnp Length = 319 Back     alignment and structure
>pdb|2GDJ|A Chain A, Delta-62 Rada Recombinase In Complex With Amp-Pnp And Magnesium Length = 264 Back     alignment and structure
>pdb|4DC9|A Chain A, Hexameric Ring Of Methanococcus Voltae Rada Length = 266 Back     alignment and structure
>pdb|2F1H|A Chain A, Recombinase In Complex With Amp-pnp And Potassium Length = 322 Back     alignment and structure
>pdb|3ETL|A Chain A, Rada Recombinase From Methanococcus Maripaludis In Complex With Amppnp Length = 322 Back     alignment and structure
>pdb|2CVF|A Chain A, Crystal Structure Of The Radb Recombinase Length = 220 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
2z43_A324 DNA repair and recombination protein RADA; archaea 1e-70
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 2e-66
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 3e-63
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 3e-59
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 6e-59
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 1e-52
2cvh_A220 DNA repair and recombination protein RADB; filamen 2e-21
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 1e-10
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 8e-10
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 9e-10
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 2e-09
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 4e-09
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Length = 324 Back     alignment and structure
 Score =  220 bits (562), Expect = 1e-70
 Identities = 76/296 (25%), Positives = 122/296 (41%), Gaps = 47/296 (15%)

Query: 6   TPQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLP 65
           T   +    +  +K + G   +D  L GGI   ++TE   E GSGKTQ C QL+++ QLP
Sbjct: 75  TALEVKKERMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLP 134

Query: 66  SSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPK 125
              GGLS  ++Y+ TE  F   R+  ++       D N  + I+     + D  + I+  
Sbjct: 135 PEKGGLSGKAVYIDTEGTFRWERIENMAKALGLDID-NVMNNIYYIRAINTDHQIAIVDD 193

Query: 126 IESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGFG 185
           ++  +         I+LIV+DS+ + FR+++    ++L  R     K    L  +A  + 
Sbjct: 194 LQELVSKDP----SIKLIVVDSVTSHFRAEYPGR-ENLAVRQQKLNKHLHQLTRLAEVYD 248

Query: 186 LAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNED 245
           +AV++TNQV+            R          G P     G    +    R+ L ++  
Sbjct: 249 IAVIITNQVMA-----------RPDM-----FYGDPTVAVGGHTLYHVPGIRIQLKKS-- 290

Query: 246 FVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVE 301
                                  R  RR   VV APHL +    F +T EG+   E
Sbjct: 291 -----------------------RGNRRIARVVDAPHLPEGEVVFALTEEGIRDAE 323


>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Length = 343 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Length = 243 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Length = 349 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Length = 400 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Length = 322 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Length = 220 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Length = 235 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Length = 247 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Length = 279 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 100.0
2z43_A324 DNA repair and recombination protein RADA; archaea 100.0
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 100.0
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 100.0
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 100.0
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 100.0
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 100.0
3io5_A333 Recombination and repair protein; storage dimer, i 100.0
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.97
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.97
1u94_A356 RECA protein, recombinase A; homologous recombinat 99.97
1xp8_A366 RECA protein, recombinase A; recombination, radior 99.97
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 99.97
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 99.96
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.95
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.95
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.94
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 99.93
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 99.92
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.91
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 99.9
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 99.89
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 99.87
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 99.87
2r6a_A454 DNAB helicase, replicative helicase; replication, 99.85
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.83
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 99.82
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.81
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.79
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.77
3bs4_A260 Uncharacterized protein PH0321; structural genomic 99.69
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.61
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 99.55
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 98.71
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 98.67
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 98.65
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 98.63
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 98.59
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.57
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 98.57
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 98.48
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 98.45
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 98.45
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 98.44
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 98.44
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 98.41
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.4
1g6h_A257 High-affinity branched-chain amino acid transport 98.4
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 98.39
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 98.39
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 98.39
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 98.39
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 98.37
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 98.33
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 98.33
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 98.31
1b0u_A262 Histidine permease; ABC transporter, transport pro 98.31
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.31
1ji0_A240 ABC transporter; ATP binding protein, structural g 98.3
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 98.29
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.27
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 98.26
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 98.26
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.25
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 98.24
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 98.23
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 98.21
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.21
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 98.2
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 98.17
1sgw_A214 Putative ABC transporter; structural genomics, P p 98.17
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 98.17
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 98.16
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.16
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 98.16
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.15
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.11
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.09
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 98.08
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 98.08
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 98.08
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.08
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 98.07
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.02
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 98.01
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.01
4a8j_A361 Elongator complex protein 4; transcription; 2.10A 98.01
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 98.01
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.0
3ice_A422 Transcription termination factor RHO; transcriptio 98.0
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.98
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 97.97
3oaa_A513 ATP synthase subunit alpha; rossmann fold, hydrola 97.96
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 97.96
2v1u_A387 Cell division control protein 6 homolog; DNA repli 97.94
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 97.94
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.93
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 97.92
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.91
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.91
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 97.88
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 97.88
2r9v_A515 ATP synthase subunit alpha; TM1612, structural gen 97.87
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 97.86
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.86
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.85
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 97.85
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 97.85
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 97.85
1fx0_A507 ATP synthase alpha chain; latent ATPase, thermal s 97.84
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.84
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.84
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 97.82
3bos_A242 Putative DNA replication factor; P-loop containing 97.82
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 97.8
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.8
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 97.79
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 97.75
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 97.75
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 97.74
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.74
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.74
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 97.73
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 97.71
3l0o_A427 Transcription termination factor RHO; helicase, RH 97.7
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 97.7
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 97.67
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 97.67
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.67
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 97.65
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.62
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.62
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 97.61
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.61
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 97.61
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 97.59
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 97.57
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.56
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 97.54
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 97.53
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 97.52
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 97.52
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 97.51
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 97.5
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 97.5
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.5
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.5
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.5
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 97.5
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 97.49
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.48
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.46
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.46
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 97.46
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.45
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.45
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 97.44
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.44
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.44
3gqb_A578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 97.44
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.43
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 97.4
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.39
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.38
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 97.37
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 97.37
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 97.36
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.35
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.34
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 97.34
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 97.34
2og2_A359 Putative signal recognition particle receptor; nuc 97.33
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.33
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 97.33
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.32
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.32
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 97.31
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.31
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.31
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 97.3
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.3
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.29
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.29
2xxa_A433 Signal recognition particle protein; protein trans 97.28
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.28
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.27
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 97.26
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 97.25
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.24
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 97.22
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.22
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.21
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 97.2
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.2
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 97.18
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.17
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.16
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 97.15
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.15
2ghi_A260 Transport protein; multidrug resistance protein, M 97.14
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.14
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.14
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.13
1tue_A212 Replication protein E1; helicase, replication, E1E 97.11
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.1
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 97.08
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.06
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 97.06
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.05
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.05
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 97.04
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 97.0
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.0
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 96.98
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.97
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 96.97
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.95
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.94
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.92
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.88
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 96.87
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 96.85
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.85
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 96.85
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.85
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.84
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.84
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.82
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.82
1p9r_A418 General secretion pathway protein E; bacterial typ 96.8
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 96.8
3pvs_A 447 Replication-associated recombination protein A; ma 96.8
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 96.79
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.79
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.78
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.78
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.77
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.77
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.77
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.75
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.74
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.74
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.74
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 96.73
1via_A175 Shikimate kinase; structural genomics, transferase 96.72
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.7
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.69
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.69
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.69
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 96.68
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.67
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.66
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.66
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.65
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.64
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.64
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.62
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.62
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.61
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.61
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 96.6
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 96.6
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 96.59
1oft_A161 SULA, hypothetical protein PA3008; bacterial cell 96.59
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.59
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.58
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 96.57
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.57
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.55
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.52
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.51
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.51
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.5
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 96.5
3kta_A182 Chromosome segregation protein SMC; structural mai 96.5
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 96.46
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.45
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 96.45
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.41
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.38
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.37
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.35
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.35
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.35
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.34
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.34
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 96.33
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.32
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.3
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.29
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.28
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.27
2oap_1511 GSPE-2, type II secretion system protein; hexameri 96.27
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.25
3end_A307 Light-independent protochlorophyllide reductase ir 96.25
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.24
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.21
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.2
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.19
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.19
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.18
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.17
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 96.17
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.16
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 96.16
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 96.15
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.14
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 96.13
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.12
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.12
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.11
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.1
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.09
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 96.09
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 96.06
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.06
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.05
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.05
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 96.05
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.05
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 96.05
3fwy_A314 Light-independent protochlorophyllide reductase I 96.02
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.01
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 95.97
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 95.95
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.95
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.94
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.94
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 95.91
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.91
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.89
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.89
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.89
2r62_A268 Cell division protease FTSH homolog; ATPase domain 95.88
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 95.87
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 95.84
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 95.82
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 95.81
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 95.81
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 95.8
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 95.78
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.77
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.76
2qgz_A308 Helicase loader, putative primosome component; str 95.76
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.74
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 95.74
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 95.72
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 95.72
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 95.72
2www_A349 Methylmalonic aciduria type A protein, mitochondri 95.71
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.69
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 95.65
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 95.64
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 95.61
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 95.6
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.58
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 95.57
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 95.57
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 95.57
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 95.57
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.56
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 95.55
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 95.55
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 95.54
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.53
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 95.5
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 95.5
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 95.49
2chq_A319 Replication factor C small subunit; DNA-binding pr 95.45
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 95.44
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.44
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.34
1ojl_A304 Transcriptional regulatory protein ZRAR; response 95.34
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 95.32
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 95.3
2gno_A305 DNA polymerase III, gamma subunit-related protein; 95.3
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 95.29
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 95.29
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 95.28
2fna_A357 Conserved hypothetical protein; structural genomic 95.28
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 95.27
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.19
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 95.18
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 95.17
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 95.16
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 95.16
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 95.16
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 95.13
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 95.12
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 95.09
3co5_A143 Putative two-component system transcriptional RES 95.09
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 95.09
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 95.09
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.08
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.07
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 95.06
3igf_A 374 ALL4481 protein; two-domained protein consisting o 95.05
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 95.03
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 95.03
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 94.98
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 94.98
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 94.95
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 94.95
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 94.93
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 94.93
2r44_A331 Uncharacterized protein; putative ATPase, structur 94.91
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 94.91
4aby_A415 DNA repair protein RECN; hydrolase, double strand 94.91
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 94.9
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 94.9
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 94.88
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 94.86
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 94.79
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 94.75
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 94.73
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 94.71
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 94.7
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 94.68
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 94.66
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 94.63
1e69_A322 Chromosome segregation SMC protein; structural mai 94.61
2wji_A165 Ferrous iron transport protein B homolog; membrane 94.52
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 94.51
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 94.48
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 94.4
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.38
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 94.37
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.35
3t1o_A198 Gliding protein MGLA; G domain containing protein, 94.34
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 94.32
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 94.31
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 94.3
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 94.3
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 94.3
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 94.28
4eq6_A214 Chromosome segregation in meiosis protein 2; DNA b 94.26
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 94.26
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 94.23
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 94.19
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 94.17
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 94.14
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 94.12
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 94.11
2hf9_A226 Probable hydrogenase nickel incorporation protein 94.1
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.04
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 94.03
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 94.02
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 94.01
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 94.0
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 93.99
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 93.97
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 93.97
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 93.91
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 93.9
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 93.89
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 93.87
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.87
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 93.86
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 93.8
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 93.78
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 93.78
2ged_A193 SR-beta, signal recognition particle receptor beta 93.78
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 93.73
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 93.73
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 93.71
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 93.7
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 93.7
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 93.7
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 93.69
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 93.68
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 93.66
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 93.65
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 93.65
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 93.64
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 93.59
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 93.56
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 93.55
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 93.54
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 93.52
1nrj_B218 SR-beta, signal recognition particle receptor beta 93.48
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 93.46
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 93.46
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 93.43
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 93.39
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 93.39
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 93.37
3cwq_A209 Para family chromosome partitioning protein; alpha 93.37
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 93.35
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 93.32
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 93.32
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 93.26
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 93.25
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 93.24
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 93.23
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 93.22
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 93.22
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 93.21
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 93.2
3bor_A237 Human initiation factor 4A-II; translation initiat 93.19
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
Probab=100.00  E-value=3.1e-38  Score=286.80  Aligned_cols=248  Identities=25%  Similarity=0.383  Sum_probs=193.0

Q ss_pred             cccCCCCCCccccCChhhHhhhCCCCCCCcEEEEEeCCCCcHHHHHHHHHHHccCCCcCCCCCCeEEEEeCCCCCCHHHH
Q 022155           10 LLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRL   89 (302)
Q Consensus        10 l~~~~~~~~~i~tG~~~LD~~L~GGl~~G~i~ei~G~~GsGKT~l~l~la~~~~l~~~~gg~~~~vlyid~e~~~~~~rl   89 (302)
                      +++.+.....++||++.||.+|+||+++|++++|+||||+|||+||++++.+++++...||...+|+||++|.+|+++++
T Consensus        94 ~~~~~~~~~~i~TG~~~LD~~LgGGl~~G~i~~I~G~~GsGKTtla~~la~~~~~~~~~gg~~~~vlyi~~E~~~~~~~l  173 (343)
T 1v5w_A           94 YSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRL  173 (343)
T ss_dssp             HHHHGGGCCCBCCSCHHHHHHTTSSBCSSEEEEEECCTTCTHHHHHHHHHHHTTSCBTTTBCCCEEEEEESSSCCCHHHH
T ss_pred             HHhhhcccceeecCChhHHHHhcCCCCCCeEEEEECCCCCCHHHHHHHHHHHHhcccccCCCCCeEEEEECCCCCCHHHH
Confidence            44555567899999999999999999999999999999999999999999998776554444559999999999999999


Q ss_pred             HHHHHHhCCCCCCCCCCcEEEEeCCCHHHHHHHHHHHHHHHHhccCCC-CCeeEEEEechhhhhhhccCCChhhHHHHHH
Q 022155           90 HQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSR-LPIRLIVIDSIAALFRSDFDNTMDDLKKRSF  168 (302)
Q Consensus        90 ~~i~~~~~~~~~~~~l~~i~~~~~~~~~~l~~~l~~l~~~l~~~~~~~-~~~~lvVIDsi~~~~~~~~~~~~~~~~~r~~  168 (302)
                      .+++..+.. ..+..++++++.++.+.+++.+++..+..++.+    . .++++|||||++++++.++.+. +++..|++
T Consensus       174 ~~~~~~~g~-~~~~~l~~l~~~~~~~~e~~~~ll~~l~~~i~~----~~~~~~lvVIDsl~~l~~~~~~~~-g~~~~r~~  247 (343)
T 1v5w_A          174 RDIADRFNV-DHDAVLDNVLYARAYTSEHQMELLDYVAAKFHE----EAGIFKLLIIDSIMALFRVDFSGR-GELAERQQ  247 (343)
T ss_dssp             HHHHHHTTC-CHHHHHHTEEEEECCSTTHHHHHHHHHHHHHHH----SCSSEEEEEEETSGGGHHHHCCGG-GCHHHHHH
T ss_pred             HHHHHHcCC-CHHHHHhceeEeecCCHHHHHHHHHHHHHHHHh----cCCCccEEEEechHHHHHHHhccc-ccHHHHHH
Confidence            888876542 222345788888888888887888777777753    2 5789999999999997765432 24566777


Q ss_pred             HHHHHHHHHHHHHHHcCcEEEEEecccccCCCCCCCCCccccCCccccCCCCCccccCCchhhhhcceEEEEEEecCchh
Q 022155          169 LFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVV  248 (302)
Q Consensus       169 ~l~~l~~~L~~la~~~~~~viv~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~lG~~w~~~~~~rl~l~~~~~~~~  248 (302)
                      .+.++++.|+.++++++++||++||+.+......            ++. +...+|++|..|.|.+++||+|+|.+.   
T Consensus       248 ~l~~~l~~L~~la~~~~~~Vi~~nq~~~~~~~~~------------~~~-g~~~~~~gg~~i~~~ad~~l~l~r~~~---  311 (343)
T 1v5w_A          248 KLAQMLSRLQKISEEYNVAVFVTNQMTADPGATM------------TFQ-ADPKKPIGGHILAHASTTRISLRKGRG---  311 (343)
T ss_dssp             HHHHHHHHHHHHHHHHTCEEEEEECC--------------------------------CCTTTTSSSEEEEEEESST---
T ss_pred             HHHHHHHHHHHHHHHhCCEEEEEeeceecCCCcc------------ccC-CCCCcCCchHHHHHhCCEEEEEEEcCC---
Confidence            7899999999999999999999999987654310            110 134689999999999999999998532   


Q ss_pred             cccccccCCCCCCCCCCcccccceEEEEEEECCCCCCceeeEEEecCcccccC
Q 022155          249 RENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVE  301 (302)
Q Consensus       249 ~~~~~~~g~~~~~~~~~~~~~~~~R~~~v~ks~~~~~~~~~F~I~~~Gi~~~~  301 (302)
                                            ..|.++|.|+|+.|...+.|.|++.||++++
T Consensus       312 ----------------------~~r~~~v~K~r~~p~~~~~f~I~~~Gi~~~~  342 (343)
T 1v5w_A          312 ----------------------ELRIAKIYDSPEMPENEATFAITAGGIGDAK  342 (343)
T ss_dssp             ----------------------TEEEEEEEECTTCCSSCEEEEEETTEEEECC
T ss_pred             ----------------------CEEEEEEEECCCCCCeeEEEEEeCCCccCCC
Confidence                                  4789999999999988999999999999886



>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>4a8j_A Elongator complex protein 4; transcription; 2.10A {Saccharomyces cerevisiae} PDB: 4ejs_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1oft_A SULA, hypothetical protein PA3008; bacterial cell division inhibitor, FTSZ, SULA protein; 2.9A {Pseudomonas aeruginosa} SCOP: c.37.1.22 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>4eq6_A Chromosome segregation in meiosis protein 2; DNA binding protein; 1.80A {Saccharomyces cerevisiae} PDB: 4dt1_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 302
d1v5wa_258 c.37.1.11 (A:) Meiotic recombination protein DMC1/ 6e-34
d1pzna2254 c.37.1.11 (A:96-349) DNA repair protein Rad51, cat 6e-33
d1szpa2251 c.37.1.11 (A:145-395) DNA repair protein Rad51, ca 1e-30
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 2e-28
d2i1qa2258 c.37.1.11 (A:65-322) DNA repair protein Rad51, cat 3e-28
d1xp8a1268 c.37.1.11 (A:15-282) RecA protein, ATPase-domain { 3e-20
d1u94a1263 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {E 7e-20
d1mo6a1269 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {M 1e-16
d1tf7a2242 c.37.1.11 (A:256-497) Circadian clock protein KaiC 1e-11
d1tf7a1242 c.37.1.11 (A:14-255) Circadian clock protein KaiC 5e-10
d1nlfa_274 c.37.1.11 (A:) Hexameric replicative helicase repA 1e-06
d1cr2a_277 c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), 0.003
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Meiotic recombination protein DMC1/LIM15 homolog
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  122 bits (306), Expect = 6e-34
 Identities = 62/297 (20%), Positives = 110/297 (37%), Gaps = 43/297 (14%)

Query: 5   MTPQNLLDNPLTTEKCTVGCPIIDRCLGGGIPCNSITELVAESGSGKTQFCLQLTLSAQL 64
           +T     +        T G    D+ LGGGI   +ITE   E  +GKTQ    L ++AQL
Sbjct: 4   LTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQL 63

Query: 65  PSSHGGLSASSLYLHTEFPFPMRRLHQLSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMP 124
           P + G      +++ TE  F   RL  ++      +     D +     ++ +  ++++ 
Sbjct: 64  PGAGGYPGGKIIFIDTENTFRPDRLRDIAD-RFNVDHDAVLDNVLYARAYTSEHQMELLD 122

Query: 125 KIESFIKNSSNSRLPIRLIVIDSIAALFRSDFDNTMDDLKKRSFLFFKISGMLKAMAVGF 184
            + +     +      +L++IDSI ALFR DF     +L +R     ++   L+ ++  +
Sbjct: 123 YVAAKFHEEAG---IFKLLIIDSIMALFRVDFSG-RGELAERQQKLAQMLSRLQKISEEY 178

Query: 185 GLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNE 244
            +AV VTNQ+                          P  P  G   A+   +R+ L +  
Sbjct: 179 NVAVFVTNQMTADPGATMT-------------FQADPKKPIGGHILAHASTTRISLRKG- 224

Query: 245 DFVVRENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLADTSCEFEITREGVFGVE 301
                                   R   R   +  +P + +    F IT  G+   +
Sbjct: 225 ------------------------RGELRIAKIYDSPEMPENEATFAITAGGIGDAK 257


>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 254 Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 258 Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Length = 268 Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Length = 263 Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 269 Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Length = 277 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 100.0
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 100.0
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 100.0
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 100.0
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 100.0
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 100.0
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 100.0
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 99.97
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 99.95
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 99.94
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 99.87
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 99.82
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.97
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 98.97
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 98.8
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 98.8
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 98.8
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 98.71
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 98.69
d1g2912240 Maltose transport protein MalK, N-terminal domain 98.67
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 98.55
d1okkd2207 GTPase domain of the signal recognition particle r 98.54
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 98.52
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 98.5
d2qy9a2211 GTPase domain of the signal recognition particle r 98.48
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 98.46
d2hyda1255 Putative multidrug export ATP-binding/permease pro 98.46
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 98.46
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.45
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 98.43
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 98.41
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 98.39
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 98.39
d1vmaa2213 GTPase domain of the signal recognition particle r 98.38
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.34
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 98.3
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.29
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.28
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.12
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 98.11
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.05
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 98.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.95
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.87
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.81
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 97.81
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.71
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 97.7
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.59
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.57
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.54
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.5
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.49
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.43
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.41
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.38
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.37
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.35
d1xpua3289 Transcription termination factor Rho, ATPase domai 97.33
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.32
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.3
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.29
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 97.29
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.28
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.27
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.25
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.22
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.22
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.21
d1svma_362 Papillomavirus large T antigen helicase domain {Si 97.21
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.2
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.2
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.14
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 97.14
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.14
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.13
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.12
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 97.04
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.03
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.0
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.98
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.96
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.94
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.91
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.91
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.9
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.89
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.87
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.83
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.82
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.8
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.75
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.73
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.73
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.71
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.69
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.63
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.6
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.59
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.57
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.56
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 96.54
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.49
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.47
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.45
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.45
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.44
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.4
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.4
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.38
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.32
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 96.3
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.29
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 96.28
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.25
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.21
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 96.18
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.16
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.14
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.11
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.1
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.05
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 96.05
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 95.99
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.91
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.9
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.87
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.85
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.83
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 95.82
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 95.81
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.8
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 95.75
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.7
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.67
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 95.65
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 95.63
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 95.61
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 95.57
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.52
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 95.43
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 95.36
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.34
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 95.24
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.23
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.22
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 95.19
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.15
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.11
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.1
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.03
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.98
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 94.97
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.96
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 94.9
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.88
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.87
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 94.82
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.82
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.78
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.77
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.73
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.69
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.62
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.58
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.58
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.46
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 94.43
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.41
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 94.41
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.4
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 94.39
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 94.38
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 94.36
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 94.27
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.25
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.2
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 94.18
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 94.16
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.12
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 94.11
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.11
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.09
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 94.09
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.04
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.99
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.98
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.96
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.93
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.9
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.89
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.87
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 93.85
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 93.83
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 93.83
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.79
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 93.79
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.76
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.73
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.72
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 93.71
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.67
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 93.67
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.65
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 93.64
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.6
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 93.54
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 93.51
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 93.51
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 93.51
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 93.51
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.45
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 93.44
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 93.41
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.34
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.34
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 93.3
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 93.26
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 93.24
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 93.18
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 93.1
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 93.09
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 93.07
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 93.05
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.05
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 93.0
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 92.95
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 92.93
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.79
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 92.79
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 92.77
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 92.7
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.66
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 92.44
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.41
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.32
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.26
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 92.23
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 92.21
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 92.17
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 92.05
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 92.0
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 91.75
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 91.64
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 91.4
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 91.38
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 91.23
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.19
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 90.87
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.8
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 90.71
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 90.44
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 89.99
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 89.69
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 89.23
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 89.05
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.77
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 88.7
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.18
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 87.86
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 87.27
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 87.07
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 86.17
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 85.83
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 85.16
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 84.56
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 84.05
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 83.93
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 83.78
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 82.39
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: RecA protein, ATPase-domain
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.4e-38  Score=275.14  Aligned_cols=230  Identities=23%  Similarity=0.292  Sum_probs=173.4

Q ss_pred             CCCCCCccccCChhhHhhhC-CCCCCCcEEEEEeCCCCcHHHHHHHHHHHccCCCcCCCCCCeEEEEeCCCCCCHHHHHH
Q 022155           13 NPLTTEKCTVGCPIIDRCLG-GGIPCNSITELVAESGSGKTQFCLQLTLSAQLPSSHGGLSASSLYLHTEFPFPMRRLHQ   91 (302)
Q Consensus        13 ~~~~~~~i~tG~~~LD~~L~-GGl~~G~i~ei~G~~GsGKT~l~l~la~~~~l~~~~gg~~~~vlyid~e~~~~~~rl~~   91 (302)
                      .....++||||++.||.+|+ ||||+|.+++|+||||+||||||++++++++   ..|+   .|+|||+|++++++|++.
T Consensus        28 ~~~~~~~isTG~~~lD~~Lg~GGi~~g~itei~G~~gsGKTtl~l~~~~~~q---~~g~---~~vyidtE~~~~~~~a~~  101 (263)
T d1u94a1          28 RSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQ---REGK---TCAFIDAEHALDPIYARK  101 (263)
T ss_dssp             CBCCCCEECCSCHHHHHHTSSSSEETTSEEEEECSTTSSHHHHHHHHHHHHH---HTTC---CEEEEESSCCCCHHHHHH
T ss_pred             cCCCCCeEccCCHHHHHHhcCCCccCceEEEEecCCCcHHHHHHHHHHHHHH---cCCC---EEEEEccccccCHHHHHH
Confidence            44457899999999999997 9999999999999999999999999999998   5566   899999999999998877


Q ss_pred             HHHHhCCCCCCCCCCcEEEEeCCCHHHHHHHHHHHHHHHHhccCCCCCeeEEEEechhhhhh-hccCCChh--hHHHHHH
Q 022155           92 LSHTFRPSNDHNPCDYIFVQSVHSVDQLLDIMPKIESFIKNSSNSRLPIRLIVIDSIAALFR-SDFDNTMD--DLKKRSF  168 (302)
Q Consensus        92 i~~~~~~~~~~~~l~~i~~~~~~~~~~l~~~l~~l~~~l~~~~~~~~~~~lvVIDsi~~~~~-~~~~~~~~--~~~~r~~  168 (302)
                      ++.         .++++++.++.+.++..+.+..   ++.+     .++++|||||++++++ .++..+.+  ....+.+
T Consensus       102 ~Gv---------d~d~v~~~~~~~~E~~~~~i~~---l~~~-----~~~~liViDSi~al~~~~e~~~~~~~~~~~~~a~  164 (263)
T d1u94a1         102 LGV---------DIDNLLCSQPDTGEQALEICDA---LARS-----GAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAAR  164 (263)
T ss_dssp             TTC---------CGGGCEEECCSSHHHHHHHHHH---HHHH-----TCCSEEEEECGGGCCCHHHHTTC------CHHHH
T ss_pred             hCC---------CHHHEEEecCCCHHHHHHHHHH---HHhc-----CCCCEEEEECccccccchhcccccccchHHHHHH
Confidence            752         3578999999988887666544   4443     5679999999999984 23322211  2334566


Q ss_pred             HHHHHHHHHHHHHHHcCcEEEEEecccccCCCCCCCCCccccCCccccCCCCCccccCCchhhhhcceEEEEEEecCchh
Q 022155          169 LFFKISGMLKAMAVGFGLAVLVTNQVVDLMEPNEGVNGLRVGNLGCLYSSGRPICPALGIAWANCVNSRLFLSRNEDFVV  248 (302)
Q Consensus       169 ~l~~l~~~L~~la~~~~~~viv~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~lG~~w~~~~~~rl~l~~~~~~~~  248 (302)
                      .+..+++.|..++.++++++|++||++.++...+                +.+.+|++|.+|.|++++||.|.|....+ 
T Consensus       165 ~l~~~~~~l~~~~~~~~~~vi~~NQv~~~~~~~~----------------g~~~~~~GG~al~~~~~~rl~l~k~~~~k-  227 (263)
T d1u94a1         165 MMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMF----------------GNPETTTGGNALKFYASVRLDIRRIGAVK-  227 (263)
T ss_dssp             HHHHHHHHHHHHHHHHTCEEEEEEC------------------------------CTTCSHHHHHCSEEEEEEEEEEEE-
T ss_pred             HHHHHHHHHHHhhhccCceEEEEEEEEecccccc----------------CCCccccccchhheeeEEEEEEEeccccc-
Confidence            7889999999999999999999999998776432                23568999999999999999998865421 


Q ss_pred             cccccccCCCCCCCCCCcccccceEEEEEEECCCCC-CceeeEEEe-cCcc
Q 022155          249 RENQMVNGGVGGSGSEDFVCRRTRRSLHVVFAPHLA-DTSCEFEIT-REGV  297 (302)
Q Consensus       249 ~~~~~~~g~~~~~~~~~~~~~~~~R~~~v~ks~~~~-~~~~~F~I~-~~Gi  297 (302)
                       ++....              ..+++++++|++..| ...+.|.|+ ++||
T Consensus       228 -~g~~~i--------------G~~~r~~v~Knr~~~p~~~~~f~i~~~~GI  263 (263)
T d1u94a1         228 -EGENVV--------------GSETRVKVVKNKIAAPFKQAEFQILYGEGI  263 (263)
T ss_dssp             -SSSSEE--------------EEEEEEEEEEESSBCSCCEEEEEEETTTEE
T ss_pred             -cCCcee--------------eeEEEEEEEeCCCCCCCCEEEEEEEcCCCC
Confidence             111122              256678999998774 568999999 8887



>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure