Citrus Sinensis ID: 022205


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-
MVTKTEETQLNRLENQVDNGGGGAWEYLCLVKKLKVRRPDKVLRHGLSILNDPKKRSALGPDVWTLYEQVSIAAMDCQCLDVAKDCIKVLQKQFPESKRVGRLEGILLEAKGLWAEAEKAYSSLLEDNPLDPVLHKRRVAIAKAQGNFPTAIEWLNKYLETFMADHDAWRELAEIYVSLQMYKQAAFCYEELILSQPTVPLYHLAYADVLYTLGGVDNILLAKKYYASTIDLTGGKNTKALFGICLCSSAIAQLTKGRNKEDKESPELQSLAAAALEKDYKQRAPAKLLLLTSALKSLKTS
cccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccc
**********NRLENQVDNGGGGAWEYLCLVKKLKVRRPDKVLRHGLSILNDPKKRSALGPDVWTLYEQVSIAAMDCQCLDVAKDCIKVLQKQFPESKRVGRLEGILLEAKGLWAEAEKAYSSLLEDNPLDPVLHKRRVAIAKAQGNFPTAIEWLNKYLETFMADHDAWRELAEIYVSLQMYKQAAFCYEELILSQPTVPLYHLAYADVLYTLGGVDNILLAKKYYASTIDLTGGKNTKALFGICLCSSAIAQ*************ELQSLAAAALE*****************LKSLKT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTKTEETQLNRLENQVDNGGGGAWEYLCLVKKLKVRRPDKVLRHGLSILNDPKKRSALGPDVWTLYEQVSIAAMDCQCLDVAKDCIKVLQKQFPESKRVGRLEGILLEAKGLWAEAEKAYSSLLEDNPLDPVLHKRRVAIAKAQGNFPTAIEWLNKYLETFMADHDAWRELAEIYVSLQMYKQAAFCYEELILSQPTVPLYHLAYADVLYTLGGVDNILLAKKYYASTIDLTGGKNTKALFGICLCSSAIAQLTKGRNKEDKESPELQSLAAAALEKDYKQRAPAKLLLLTSALKSLKTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ER membrane protein complex subunit 2 probableQ5M7J9
ER membrane protein complex subunit 2 probableQ5R882
ER membrane protein complex subunit 2 probableB0BNG0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y4T, chain A
Confidence level:very confident
Coverage over the Query: 61-256
View the alignment between query and template
View the model in PyMOL
Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 22-259
View the alignment between query and template
View the model in PyMOL
Template: 2XPI, chain A
Confidence level:very confident
Coverage over the Query: 36-285
View the alignment between query and template
View the model in PyMOL