Citrus Sinensis ID: 022251

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
MAPPTVIRWYAITSAIVLLLLISPSVAIYCDEDDCYDLLGVSQNANSSEIKKAYYKLSLKYHPDKNPDPDSRKLFVKIANAYEILKDEATREQYDYAIAHPEEVFYNAARYYHAYYGHKTDPRAVLVGLLLIFSGFQYLNQWTRYNQAVAMVKKTPAYRNKLRALELERSGGIPNKKKSNKQMDKKTGEDLSKELDLQIKGAEKPSVWELIGVRLILLPYTIGKLLLWWGRWYWRYNVKKASYAWEDALYLTQKSLRVPHDAWMNIDESKKEDLVNRRLWEKSNLESYLAEMRKESKRRR
cccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccHHHccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccHHHHHHHHHHHccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MAPPTVIRWYAITSAIVLLLLIspsvaiycdeddcydllgvsqnanSSEIKKAYYKLSLkyhpdknpdpdsRKLFVKIANAYEILKDEATREQYDYAIAHPEEVFYNAARYYHAyyghktdpRAVLVGLLLIFSGFQYLNQWTRYNQAVAMVKKTPAYRNKLRALELErsggipnkkksnkqmdkkTGEDLSKELDLqikgaekpsVWELIGVRLILLPYTIGKLLLWWGRWYWRYNVKKASYAWEDALYLTQkslrvphdawmnideskkedLVNRRLWEKSNLESYLAEMRKESKRRR
MAPPTVIRWYAITSAIVLLLLISPSVAIYCDEDDCYDLLGVSQNANSSEIKKAYYKLSLKYHpdknpdpdsRKLFVKIANAYEILKDEATREQYDYAIAHPEEVFYNAARYYHAYYGHKTDPRAVLVGLLLIFSGFQYLNQWTRYNQAVAMVKKTPAYRNKLRALelersggipnkkksnkqmdkktGEDLSKELDLQIKGAEKPSVWELIGVRLILLPYTIGKLLLWWGRWYWRYNVKKASYAWEDALYLTQKSLRVPHDawmnideskkedlvnrrlweksnlesylaemrkeskrrr
MAPPTVIRWYAITSAIVLLLLISPSVAIYCDEDDCYDLLGVSQNANSSEIKKAYYKLSLKYHPDKNPDPDSRKLFVKIANAYEILKDEATREQYDYAIAHPEEVFYNAARYYHAYYGHKTDPRAVLVGLLLIFSGFQYLNQWTRYNQAVAMVKKTPAYRNKLRALELERSGGIPNkkksnkqmdkkTGEDLSKELDLQIKGAEKPSVWELIGVRLILLPYTIGKlllwwgrwywryNVKKASYAWEDALYLTQKSLRVPHDAWMNIDESKKEDLVNRRLWEKSNLESYLAEMRKESKRRR
****TVIRWYAITSAIVLLLLISPSVAIYCDEDDCYDLLGVSQNANSSEIKKAYYKLSLKY***********KLFVKIANAYEILKDEATREQYDYAIAHPEEVFYNAARYYHAYYGHKTDPRAVLVGLLLIFSGFQYLNQWTRYNQAVAMVKKTPAYRNKL*****************************************KPSVWELIGVRLILLPYTIGKLLLWWGRWYWRYNVKKASYAWEDALYLTQKSLRVPHDAWMNID******LVNRRLW********************
******IRWYAITSAIVLLLLISPSVAIYCDEDDCYDLLGVSQNANSSEIKKAYYKLSLKYHPDKNPDPDSRKLFVKIANAYEILKDEATREQYDYAIAHP**********YHAYYGHKTDPRAVLVGLLLIFSGFQYL*********************************************************LQIKGAEKPSVWELIGVRLILLPYTIGKLLLWWGRWYWRYNVKKASYAWEDALYLTQKSLRVPHDAWMNIDESKKEDLVNRRLWEKSNLESYL***********
MAPPTVIRWYAITSAIVLLLLISPSVAIYCDEDDCYDLLGVSQNANSSEIKKAYYKLSLKYHPDKNPDPDSRKLFVKIANAYEILKDEATREQYDYAIAHPEEVFYNAARYYHAYYGHKTDPRAVLVGLLLIFSGFQYLNQWTRYNQAVAMVKKTPAYRNKLRALELERSGGIPN***************LSKELDLQIKGAEKPSVWELIGVRLILLPYTIGKLLLWWGRWYWRYNVKKASYAWEDALYLTQKSLRVPHDAWMNIDESKKEDLVNRRLWEKSNLESYLA**********
*APPTVIRWYAITSAIVLLLLISPSVAIYCDEDDCYDLLGVSQNANSSEIKKAYYKLSLKYHPDKNPDPDSRKLFVKIANAYEILKDEATREQYDYAIAHPEEVFYNAARYYHAYYGHKTDPRAVLVGLLLIFSGFQYLNQWTRYNQAVAMVKKTPAYRNKLRALELERSGGI*******KQMDKKTGEDLSKELDLQIKGAEKPSVWELIGVRLILLPYTIGKLLLWWGRWYWRYNVKKASYAWEDALYLTQKSLRVPHDAWMNIDESKKEDLVNRRLWEKSNLESYLAEMRKE*****
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPPTVIRWYAITSAIVLLLLISPSVAIYCDEDDCYDLLGVSQNANSSEIKKAYYKLSLKYHPDKNPDPDSRKLFVKIANAYEILKDEATREQYDYAIAHPEEVFYNAARYYHAYYGHKTDPRAVLVGLLLIFSGFQYLNQWTRYNQAVAMVKKTPAYRNKLRALELERSGGIPNKKKSNKQMDKKTGEDLSKELDLQIKGAEKPSVWELIGVRLILLPYTIGKLLLWWGRWYWRYNVKKASYAWEDALYLTQKSLRVPHDAWMNIDESKKEDLVNRRLWEKSNLESYLAEMRKESKRRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query300 2.2.26 [Sep-21-2011]
Q58E03344 DnaJ homolog subfamily C N/A no 0.966 0.843 0.319 2e-40
Q5HZT9368 DnaJ homolog subfamily C yes no 0.903 0.736 0.319 3e-38
Q9H1X3360 DnaJ homolog subfamily C yes no 0.903 0.752 0.309 4e-36
A2ALW5357 DnaJ homolog subfamily C yes no 0.903 0.759 0.318 6e-35
Q9VXT2333 DnaJ homolog subfamily C yes no 0.896 0.807 0.340 3e-34
Q5BJW9357 DnaJ homolog subfamily C yes no 0.903 0.759 0.311 3e-34
Q17433337 DnaJ homolog dnj-2 OS=Cae yes no 0.903 0.804 0.308 1e-31
Q6NRT6 796 DnaJ homolog subfamily C N/A no 0.266 0.100 0.567 5e-18
Q9QYI6222 DnaJ homolog subfamily B no no 0.3 0.405 0.425 3e-14
Q10209 392 Uncharacterized J domain- yes no 0.273 0.209 0.471 3e-14
>sp|Q58E03|DJC25_XENLA DnaJ homolog subfamily C member 25 OS=Xenopus laevis GN=dnajc25 PE=2 SV=1 Back     alignment and function desciption
 Score =  166 bits (420), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/316 (31%), Positives = 171/316 (54%), Gaps = 26/316 (8%)

Query: 8   RWYAITSAIVLLLLISPSV---AIYCDEDDCYDLLGVSQNANSSEIKKAYYKLSLKYHPD 64
           RW  + +  VL L          +YC    CYD+LGVS++AN  +I +AY +L+ KYHPD
Sbjct: 4   RWVLLVALSVLFLSGRAGALTEGLYCGRQVCYDVLGVSRDANKGDIARAYRQLARKYHPD 63

Query: 65  K-------NPDPDSRKL----FVKIANAYEILKDEATREQYDYAIAHPEEVFYNAARYYH 113
           +        PD ++R+     F+ +A AYE LKDE TR+ YDY + HPEE + +   YY 
Sbjct: 64  RYRPGDQLGPDGETRESAQEKFILVATAYETLKDEETRKDYDYMLDHPEEYYRHYYHYYS 123

Query: 114 AYYGHKTDPRAVLVGLLLIFSGFQYLNQWTRYNQAVAMVKKTPAYRNKLRALELERSGGI 173
                K D R V++  +   S FQY + W+ YN+A+  +     YR  ++A+E+ +  G+
Sbjct: 124 RRLAPKVDVRIVILVSVCAVSIFQYYSWWSSYNEAINYLATVTKYR--IQAMEIAKQQGL 181

Query: 174 PNKKKSNKQMDKKTGEDLSKEL---------DLQIKGA-EKPSVWELIGVRLILLPYTIG 223
            N+ K   +  +   E  S+E           + IKG  +KP +++++  ++IL PY + 
Sbjct: 182 LNRTKEKGKNRRSKEEIKSEEEEIIRDIIKNKIDIKGGYQKPQIFDILLFQIILFPYYMF 241

Query: 224 KLLLWWGRWYWRYNVKKASYAWEDALYLTQKSLRVPHDAWMNIDESKKEDLVNRRLWEKS 283
           K + W+ RW + +N++   Y  E+ LYL +K +++    +  ++E +K   + ++LW K 
Sbjct: 242 KYISWYVRWIYTFNIQGKEYGEEEKLYLIRKYMKMSQSQFDTLEEHRKNTFLEQKLWIKE 301

Query: 284 NLESYLAEMRKESKRR 299
           N E Y  E  +E+K++
Sbjct: 302 NYEVYRQEQEEETKKK 317

Xenopus laevis (taxid: 8355)
>sp|Q5HZT9|DJC25_XENTR DnaJ homolog subfamily C member 25 OS=Xenopus tropicalis GN=dnajc25 PE=2 SV=1 Back     alignment and function description
>sp|Q9H1X3|DJC25_HUMAN DnaJ homolog subfamily C member 25 OS=Homo sapiens GN=DNAJC25 PE=2 SV=1 Back     alignment and function description
>sp|A2ALW5|DJC25_MOUSE DnaJ homolog subfamily C member 25 OS=Mus musculus GN=Dnajc25 PE=2 SV=1 Back     alignment and function description
>sp|Q9VXT2|DJC25_DROME DnaJ homolog subfamily C member 25 homolog OS=Drosophila melanogaster GN=CG7872 PE=2 SV=1 Back     alignment and function description
>sp|Q5BJW9|DJC25_RAT DnaJ homolog subfamily C member 25 OS=Rattus norvegicus GN=Dnajc25 PE=2 SV=1 Back     alignment and function description
>sp|Q17433|DNJ2_CAEEL DnaJ homolog dnj-2 OS=Caenorhabditis elegans GN=dnj-2 PE=1 SV=1 Back     alignment and function description
>sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 Back     alignment and function description
>sp|Q9QYI6|DNJB9_MOUSE DnaJ homolog subfamily B member 9 OS=Mus musculus GN=Dnajb9 PE=2 SV=2 Back     alignment and function description
>sp|Q10209|YAY1_SCHPO Uncharacterized J domain-containing protein C4H3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.01 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query300
356536059305 PREDICTED: dnaJ homolog subfamily C memb 0.993 0.977 0.804 1e-137
224078754302 predicted protein [Populus trichocarpa] 0.993 0.986 0.786 1e-136
363807436305 uncharacterized protein LOC100792705 pre 0.993 0.977 0.801 1e-136
255554999300 Cysteine string protein, putative [Ricin 1.0 1.0 0.81 1e-135
449454710299 PREDICTED: dnaJ homolog subfamily C memb 0.996 1.0 0.78 1e-131
359483318295 PREDICTED: dnaJ homolog subfamily C memb 0.983 1.0 0.813 1e-130
302144064 411 unnamed protein product [Vitis vinifera] 0.983 0.717 0.813 1e-130
218196321310 hypothetical protein OsI_18963 [Oryza sa 0.92 0.890 0.735 1e-118
357128224334 PREDICTED: dnaJ homolog subfamily C memb 0.92 0.826 0.728 1e-117
115488058309 Os12g0258200 [Oryza sativa Japonica Grou 0.92 0.893 0.728 1e-117
>gi|356536059|ref|XP_003536558.1| PREDICTED: dnaJ homolog subfamily C member 25-like [Glycine max] Back     alignment and taxonomy information
 Score =  494 bits (1273), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 243/302 (80%), Positives = 263/302 (87%), Gaps = 4/302 (1%)

Query: 3   PPTVIRWYAITSAIVLLLL----ISPSVAIYCDEDDCYDLLGVSQNANSSEIKKAYYKLS 58
           PP  IRW A      +L+L    ISPS AIYCDEDDCYDLLGV+Q+AN+SEIKKAYYKLS
Sbjct: 4   PPVPIRWRATAIPFFVLVLFLSTISPSRAIYCDEDDCYDLLGVTQSANASEIKKAYYKLS 63

Query: 59  LKYHPDKNPDPDSRKLFVKIANAYEILKDEATREQYDYAIAHPEEVFYNAARYYHAYYGH 118
           LKYHPDKNPDP+SRKLFVK+ANAYEILKDEATREQYDYAIAHPEEVFYN ARYY AYYGH
Sbjct: 64  LKYHPDKNPDPESRKLFVKVANAYEILKDEATREQYDYAIAHPEEVFYNTARYYRAYYGH 123

Query: 119 KTDPRAVLVGLLLIFSGFQYLNQWTRYNQAVAMVKKTPAYRNKLRALELERSGGIPNKKK 178
           KTDPRAVLVGLLLI SGFQYLNQ TRYNQAVAMVKKTPAY+NKLRALELERSGG+ NKKK
Sbjct: 124 KTDPRAVLVGLLLILSGFQYLNQSTRYNQAVAMVKKTPAYKNKLRALELERSGGVTNKKK 183

Query: 179 SNKQMDKKTGEDLSKELDLQIKGAEKPSVWELIGVRLILLPYTIGKLLLWWGRWYWRYNV 238
           S K MDKKT EDLSKELDLQI GAE PSVW+L+GVR +LLPYT+GKLLLW   W+WRY V
Sbjct: 184 SQKNMDKKTEEDLSKELDLQITGAEMPSVWKLLGVRFVLLPYTLGKLLLWTACWFWRYKV 243

Query: 239 KKASYAWEDALYLTQKSLRVPHDAWMNIDESKKEDLVNRRLWEKSNLESYLAEMRKESKR 298
           KK  Y+ EDA YLTQ+SL +P D W NIDE+ KEDLV RRLWEKSNLE+Y+AEMRKESKR
Sbjct: 244 KKYPYSLEDASYLTQRSLSIPLDRWRNIDEATKEDLVLRRLWEKSNLENYVAEMRKESKR 303

Query: 299 RR 300
           RR
Sbjct: 304 RR 305

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224078754|ref|XP_002305615.1| predicted protein [Populus trichocarpa] gi|222848579|gb|EEE86126.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|363807436|ref|NP_001242387.1| uncharacterized protein LOC100792705 precursor [Glycine max] gi|255648365|gb|ACU24633.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255554999|ref|XP_002518537.1| Cysteine string protein, putative [Ricinus communis] gi|223542382|gb|EEF43924.1| Cysteine string protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449454710|ref|XP_004145097.1| PREDICTED: dnaJ homolog subfamily C member 25-like [Cucumis sativus] gi|449471953|ref|XP_004153452.1| PREDICTED: dnaJ homolog subfamily C member 25-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359483318|ref|XP_002265115.2| PREDICTED: dnaJ homolog subfamily C member 25 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302144064|emb|CBI23169.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|218196321|gb|EEC78748.1| hypothetical protein OsI_18963 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|357128224|ref|XP_003565774.1| PREDICTED: dnaJ homolog subfamily C member 25-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|115488058|ref|NP_001066516.1| Os12g0258200 [Oryza sativa Japonica Group] gi|77554498|gb|ABA97294.1| DnaJ domain containing protein, expressed [Oryza sativa Japonica Group] gi|77554499|gb|ABA97295.1| DnaJ domain containing protein, expressed [Oryza sativa Japonica Group] gi|113649023|dbj|BAF29535.1| Os12g0258200 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query300
TAIR|locus:2195723300 AT1G61770 [Arabidopsis thalian 1.0 1.0 0.656 9.5e-105
UNIPROTKB|Q9H1X3360 DNAJC25 "DnaJ homolog subfamil 0.966 0.805 0.301 9.9e-39
MGI|MGI:1919679357 Dnajc25 "DnaJ (Hsp40) homolog, 0.963 0.809 0.308 1.3e-38
RGD|1561488357 Dnajc25 "DnaJ (Hsp40) homolog, 0.963 0.809 0.302 1.6e-38
FB|FBgn0030658333 CG7872 [Drosophila melanogaste 0.936 0.843 0.310 2.4e-35
WB|WBGene00001020337 dnj-2 [Caenorhabditis elegans 0.87 0.774 0.277 1.8e-25
GENEDB_PFALCIPARUM|PF11_0443321 PF11_0443 "hypothetical protei 0.866 0.809 0.251 3.8e-23
UNIPROTKB|Q8IHT4321 PF11_0443 "DNAJ protein, putat 0.866 0.809 0.251 3.8e-23
ZFIN|ZDB-GENE-040115-3 474 dnaja3b "DnaJ (Hsp40) homolog, 0.34 0.215 0.424 2.3e-16
UNIPROTKB|F1NNE0393 DNAJA3 "Uncharacterized protei 0.353 0.269 0.414 6.2e-16
TAIR|locus:2195723 AT1G61770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1037 (370.1 bits), Expect = 9.5e-105, P = 9.5e-105
 Identities = 197/300 (65%), Positives = 229/300 (76%)

Query:     1 MAPPTVIRWYAITSAIVLLLLISPSVAIYCDEDDCYDLLGVSQNANSSEIKKAYYKLSLK 60
             MAPP   RW      + L L +  S AIYC  +DCY LLGV+Q+AN+S+IK++YYKLSL+
Sbjct:     1 MAPPVTERWCLALILLFLSLFVQSSTAIYCGAEDCYALLGVAQDANASDIKRSYYKLSLQ 60

Query:    61 YHPDKNPDPDSRKLFVKIANAYEILKDEATREQYDYAIAHPEEVFYNAARYYHAYYGHKT 120
             +HPDKNPDP+SRKLFVKIA AYEILKD  TR QYDYAI HPEEVFYN A+YY A YGHK+
Sbjct:    61 HHPDKNPDPESRKLFVKIATAYEILKDNTTRAQYDYAIEHPEEVFYNTAQYYRAKYGHKS 120

Query:   121 DPRAVLVGLLLIFSGFQYLNQWTRYNQAVAMVKKTPAYRNKLRALELERSGGIPNXXXXX 180
             DPRAVLVGLL++ S FQYLN   RYN+A+A VK+TPAY+NKL+ALELER+GG+ N     
Sbjct:   121 DPRAVLVGLLVVLSAFQYLNNVARYNEAIATVKRTPAYKNKLKALELERTGGVSNKKKGS 180

Query:   181 XXXXXXTGEDLSKELDLQIKGAEKPSVWELIGVRLILLPYTIGKXXXXXXXXXXXXNVKK 240
                     E+LS ELDLQIKGAEKPSVWEL+GVR ILLPYTI K             VKK
Sbjct:   181 KQIDQKLQEELSNELDLQIKGAEKPSVWELLGVRFILLPYTIIKLLVWYSSWVWRYKVKK 240

Query:   241 ASYAWEDALYLTQKSLRVPHDAWMNIDESKKEDLVNRRLWEKSNLESYLAEMRKESKRRR 300
             A Y+WEDA YLT++SL VP DAW N+DE +KEDLV +RLWEK NLE+Y AEMRKESKRRR
Sbjct:   241 APYSWEDASYLTRRSLSVPADAWANLDEYRKEDLVQKRLWEKQNLENYFAEMRKESKRRR 300
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
UNIPROTKB|Q9H1X3 DNAJC25 "DnaJ homolog subfamily C member 25" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1919679 Dnajc25 "DnaJ (Hsp40) homolog, subfamily C, member 25" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1561488 Dnajc25 "DnaJ (Hsp40) homolog, subfamily C, member 25" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0030658 CG7872 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00001020 dnj-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF11_0443 PF11_0443 "hypothetical protein, conserved" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IHT4 PF11_0443 "DNAJ protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040115-3 dnaja3b "DnaJ (Hsp40) homolog, subfamily A, member 3B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNE0 DNAJA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VXT2DJC25_DROMENo assigned EC number0.34020.89660.8078yesno
Q17433DNJ2_CAEELNo assigned EC number0.30810.90330.8041yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 2e-25
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 8e-25
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-24
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-21
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-20
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-20
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 8e-20
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 9e-20
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 9e-20
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 4e-19
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 2e-18
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 6e-18
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 7e-18
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 8e-18
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 2e-17
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 3e-17
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 4e-17
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-16
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 3e-16
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 5e-16
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 6e-16
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 1e-15
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 3e-15
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 5e-15
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 8e-15
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 8e-15
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 3e-14
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 3e-14
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 5e-14
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 1e-13
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 2e-13
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 4e-13
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 1e-12
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 1e-12
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 5e-12
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 2e-10
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 2e-09
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 1e-07
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 2e-05
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 6e-05
PHA02624 647 PHA02624, PHA02624, large T antigen; Provisional 0.002
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 0.004
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 0.004
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information 
 Score =  103 bits (259), Expect = 2e-25
 Identities = 33/62 (53%), Positives = 45/62 (72%)

Query: 34 DCYDLLGVSQNANSSEIKKAYYKLSLKYHPDKNPDPDSRKLFVKIANAYEILKDEATREQ 93
          D Y++LGVS++A+  EIKKAY KL+ KYHPD+N D ++ + F +I  AYE+L D   R Q
Sbjct: 1  DYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNKDKEAEEKFKEINEAYEVLSDPEKRAQ 60

Query: 94 YD 95
          YD
Sbjct: 61 YD 62

This model represents bacterial forms of DnaJ, part of the DnaK-DnaJ-GrpE chaperone system. The three components typically are encoded by consecutive genes. DnaJ homologs occur in many genomes, typically not near DnaK and GrpE-like genes; most such genes are not included by this family. Eukaryotic (mitochondrial and chloroplast) forms are not included in the scope of this family. Length = 354
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 300
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.89
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.89
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.86
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
PRK14288369 chaperone protein DnaJ; Provisional 99.77
PRK14296 372 chaperone protein DnaJ; Provisional 99.77
PRK14279 392 chaperone protein DnaJ; Provisional 99.73
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.73
PRK14287371 chaperone protein DnaJ; Provisional 99.73
PRK14286372 chaperone protein DnaJ; Provisional 99.72
PRK14283 378 chaperone protein DnaJ; Provisional 99.72
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.72
PRK14276 380 chaperone protein DnaJ; Provisional 99.72
PRK14298 377 chaperone protein DnaJ; Provisional 99.72
PRK14291 382 chaperone protein DnaJ; Provisional 99.71
PRK14299291 chaperone protein DnaJ; Provisional 99.71
PRK14278 378 chaperone protein DnaJ; Provisional 99.71
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.71
PRK14280 376 chaperone protein DnaJ; Provisional 99.7
PRK14282369 chaperone protein DnaJ; Provisional 99.7
PRK14285365 chaperone protein DnaJ; Provisional 99.69
PRK14277 386 chaperone protein DnaJ; Provisional 99.69
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
PRK14294366 chaperone protein DnaJ; Provisional 99.69
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.68
PRK14301 373 chaperone protein DnaJ; Provisional 99.68
PRK14295 389 chaperone protein DnaJ; Provisional 99.68
PRK14297 380 chaperone protein DnaJ; Provisional 99.68
PRK14284 391 chaperone protein DnaJ; Provisional 99.68
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
PRK10767371 chaperone protein DnaJ; Provisional 99.67
PRK14281 397 chaperone protein DnaJ; Provisional 99.66
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.66
PRK14300 372 chaperone protein DnaJ; Provisional 99.66
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.65
PRK14293 374 chaperone protein DnaJ; Provisional 99.65
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.65
PRK14290365 chaperone protein DnaJ; Provisional 99.64
PRK14292 371 chaperone protein DnaJ; Provisional 99.64
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.64
PRK14289 386 chaperone protein DnaJ; Provisional 99.63
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.62
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.6
PHA03102153 Small T antigen; Reviewed 99.56
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.53
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.51
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.47
PRK05014171 hscB co-chaperone HscB; Provisional 99.4
PRK01356166 hscB co-chaperone HscB; Provisional 99.4
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.38
PRK00294173 hscB co-chaperone HscB; Provisional 99.36
PRK03578176 hscB co-chaperone HscB; Provisional 99.32
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.25
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.24
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.24
PTZ00100116 DnaJ chaperone protein; Provisional 99.19
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.17
PHA02624 647 large T antigen; Provisional 99.14
PRK01773173 hscB co-chaperone HscB; Provisional 99.02
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.9
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.86
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.76
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 98.33
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.08
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.07
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.29
PTZ00475 282 RESA-like protein; Provisional 96.35
KOG0431453 consensus Auxilin-like protein and related protein 96.05
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.78
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.28
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 93.49
PF09320107 DUF1977: Domain of unknown function (DUF1977); Int 92.0
PF14308204 DnaJ-X: X-domain of DnaJ-containing 91.15
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-69  Score=477.11  Aligned_cols=296  Identities=45%  Similarity=0.821  Sum_probs=269.9

Q ss_pred             CCchHHHHHHHHHHHHHHHHHHhhhccccCCccccccccCcCCCCCHHHHHHHHHHHHHhhCCCCCCCcchHHHHHHHHH
Q 022251            1 MAPPTVIRWYAITSAIVLLLLISPSVAIYCDEDDCYDLLGVSQNANSSEIKKAYYKLSLKYHPDKNPDPDSRKLFVKIAN   80 (300)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~iLgv~~~as~~eIkkayr~la~~~HPDk~~~~~a~~~f~~i~~   80 (300)
                      |||+...||+.+++++...+++....++||+.+|||+||||+++++.++|.+|||+||+++|||+++++++.+.|..|.+
T Consensus         1 ~A~aat~rw~Lvl~~Llp~l~vgl~egLYCG~enCYdVLgV~Rea~KseIakAYRqLARrhHPDr~r~~e~k~~F~~iAt   80 (329)
T KOG0722|consen    1 MAPAATERWCLVLILLLPSLFVGLSEGLYCGAENCYDVLGVAREANKSEIAKAYRQLARRHHPDRNRDPESKKLFVKIAT   80 (329)
T ss_pred             CCCccchHHHHHHHHHHHHHHHhhhhhhcccchhHHHHhhhhhhccHHHHHHHHHHHHHHhCCcccCCchhhhhhhhhhc
Confidence            78999999999999999888888999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhccchhHHHhhcccccCCcccccccccccccccCCCCChhHHHHHHHHHhhhhhhhhHhHhHHHHHHHhhcCHHHHH
Q 022251           81 AYEILKDEATREQYDYAIAHPEEVFYNAARYYHAYYGHKTDPRAVLVGLLLIFSGFQYLNQWTRYNQAVAMVKKTPAYRN  160 (300)
Q Consensus        81 Ay~vL~d~~~R~~YD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~s~~~y~~~~~~y~~~~~~~~~~~~~r~  160 (300)
                      ||++|.|...|..||..+++|+..++|++.||+.++++++|++.|++|+++++|.|||++.+++|.++|.+++.+|+|+|
T Consensus        81 ayeilkd~e~rt~ydyaldhpd~~fynyyqyyr~r~apkvd~raviVGvl~i~s~Fqyls~~ary~eAI~~~~~vpkyrN  160 (329)
T KOG0722|consen   81 AYEILKDNETRTQYDYALDHPDEVFYNYYQYYRARYAPKVDPRAVIVGVLVILSAFQYLSNVARYNEAIAYVKRVPKYRN  160 (329)
T ss_pred             ccccccchhhHHhHHHHhcCchHHHHHHHHHHHHHhccccCCcEEEEeehhhhhHHHHHHHHHHHHHHHHHHhcchhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHH-------HHHhcCCCCCcccchhhhhhhhhHhHHHHHHHHhhcCCCCchhhHHHHHHHhhhHHHHHHHHHHhhhh
Q 022251          161 KLRAL-------ELERSGGIPNKKKSNKQMDKKTGEDLSKELDLQIKGAEKPSVWELIGVRLILLPYTIGKLLLWWGRWY  233 (300)
Q Consensus       161 ~~~~~-------~~e~~~~~~~~~k~k~~~~~~~~e~l~~~l~~~i~g~~kP~~~dll~vql~l~pysl~~~l~w~~~w~  233 (300)
                      .+-+.       +.++.+  ++++++....++...+.+.+++++. ||+.+|+++|+|+|+++++||+|.++|.|+..|+
T Consensus       161 ~~l~~~~de~~lem~r~G--knkk~k~~q~Devik~ii~~~lDv~-gGy~kpsiwd~L~v~~Ii~PyTI~~~ivW~a~W~  237 (329)
T KOG0722|consen  161 QALKAARDEILLEMDRNG--KNKKNKGVQNDEVIKQIIIDNLDVT-GGYKKPSIWDTLAVHTIIFPYTIFRYIVWTALWY  237 (329)
T ss_pred             hhhhccchhHHHHHHhcc--ccccccCccHHHHHHHHHHhhcccc-cCcCCccHHHHHHHHHHHhhHHHHHHHHHHHHHH
Confidence            65332       234432  3333333333333444445555555 7999999999999999999999999999999999


Q ss_pred             eeeeecCCCCchhhhHHHhhhcCCCCHHHHhhhChhHHHHHHHhhhhhhhhHHHHHHHHHHhhhhc
Q 022251          234 WRYNVKKASYAWEDALYLTQKSLRVPHDAWMNIDESKKEDLVNRRLWEKSNLESYLAEMRKESKRR  299 (300)
Q Consensus       234 ~ky~i~k~~~~~e~~~Yl~r~~l~~~~~~~~~l~~~~~~~~~~~~lW~~~n~~~~~~e~~~e~k~~  299 (300)
                      |+|+|+|+||++++++||||+++|+||.+|++-+|++.+|+++.+||.+.|+..||+||+|+|+++
T Consensus       238 WRy~v~K~pY~~e~klYLiRr~lgv~q~~f~~~~d~~i~~~~~~~~W~~~n~~~wkaeq~e~~~~k  303 (329)
T KOG0722|consen  238 WRYAVQKEPYDDEAKLYLIRRYLGVSQMEFDQKTDEDIDDLFERECWLKLNCATWKAEQDEAEQEK  303 (329)
T ss_pred             HhhhhhcCCCChHhHHHHHHHHhcchhhhhhhcchhhhhhHHHHHHHHhcCchhhhccCcHHHHHh
Confidence            999999999999999999999999999999999999999999999999999999999999999874

>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00475 RESA-like protein; Provisional Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF09320 DUF1977: Domain of unknown function (DUF1977); InterPro: IPR015399 This C-terminal domain is functionally uncharacterised and predominantly found in Dnaj-like proteins Back     alignment and domain information
>PF14308 DnaJ-X: X-domain of DnaJ-containing Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 2e-13
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 5e-13
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 5e-13
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 7e-13
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 1e-12
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 3e-12
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 8e-12
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 3e-11
2qsa_A109 Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 4e-11
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 4e-11
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 7e-11
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 3e-10
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 3e-10
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 3e-10
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 5e-10
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 6e-10
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 6e-10
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 5e-09
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 9e-09
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 1e-08
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 5e-08
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 3e-06
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 7e-06
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 1e-05
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 1e-05
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 4e-05
2ys8_A90 Solution Structure Of The Dnaj-Like Domain From Hum 7e-05
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure 
Iteration: 1

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/63 (55%), Positives = 47/63 (74%), Gaps = 1/63 (1%)
Query: 34 DCYDLLGVSQNANSSEIKKAYYKLSLKYHPDKNP-DPDSRKLFVKIANAYEILKDEATRE 92
          D Y +LGV +NA+  EIKKAYY+L+ KYHPD N  DP +++ F ++A AYE+L DE  R+
Sbjct: 8  DYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRK 67
Query: 93 QYD 95
          QYD
Sbjct: 68 QYD 70
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 3e-35
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-24
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 1e-24
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 4e-24
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 5e-24
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 6e-24
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 7e-24
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-23
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-23
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 6e-23
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-22
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 1e-22
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 2e-22
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 3e-22
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 2e-21
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 3e-21
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 3e-21
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 7e-21
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 8e-21
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 3e-20
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-20
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-19
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 3e-19
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-13
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 1e-12
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 8e-12
2guz_A71 Mitochondrial import inner membrane translocase su 3e-11
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 5e-11
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-10
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 7e-10
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 4e-08
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 1e-07
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 3e-07
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
 Score =  122 bits (307), Expect = 3e-35
 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 5/100 (5%)

Query: 27  AIYCDEDDCYDLLGVSQNANS-SEIKKAYYKLSLKYHPDKNPDPDSRKL----FVKIANA 81
            +YC  ++CYD+L V++      ++ KAY  L+ K+HPD+  + + + L    F  IA A
Sbjct: 9   ELYCGLENCYDVLEVNREEFDKQKLAKAYRALARKHHPDRVKNKEEKLLAEERFRVIATA 68

Query: 82  YEILKDEATREQYDYAIAHPEEVFYNAARYYHAYYGHKTD 121
           YE LKD+  +  YDY + HP++ FYN  +YY      K D
Sbjct: 69  YETLKDDEAKTNYDYYLDHPDQRFYNYYQYYRLRAAPKVD 108
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query300
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.88
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.82
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.82
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.82
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.81
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.8
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.8
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.79
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.79
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.78
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.77
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.77
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.76
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.76
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.76
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.75
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.72
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.7
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.69
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.68
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.67
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.67
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.65
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.64
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.64
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.64
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.64
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.63
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.63
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.61
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.56
2guz_A71 Mitochondrial import inner membrane translocase su 99.55
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.5
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.95
2guz_B65 Mitochondrial import inner membrane translocase su 98.69
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 84.88
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
Probab=99.88  E-value=8e-24  Score=168.04  Aligned_cols=100  Identities=36%  Similarity=0.673  Sum_probs=86.9

Q ss_pred             hhhccccCCccccccccCcCCCC-CHHHHHHHHHHHHHhhCCCCCCC----cchHHHHHHHHHhhhhccchhHHHhhccc
Q 022251           23 SPSVAIYCDEDDCYDLLGVSQNA-NSSEIKKAYYKLSLKYHPDKNPD----PDSRKLFVKIANAYEILKDEATREQYDYA   97 (300)
Q Consensus        23 ~~~~~~~~~~~~~Y~iLgv~~~a-s~~eIkkayr~la~~~HPDk~~~----~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~   97 (300)
                      ..+..++|+..|||+||||+++| +.++||+|||++++++|||++++    +.+.+.|+.|++||++|+||.+|..||..
T Consensus         5 ~ll~~~~~~~~~~y~iLgv~~~a~s~~eIk~aYr~l~~~~HPDk~~~~~~~~~a~~~f~~i~~AY~~L~d~~~R~~YD~~   84 (109)
T 2qsa_A            5 GFAPELYCGLENCYDVLEVNREEFDKQKLAKAYRALARKHHPDRVKNKEEKLLAEERFRVIATAYETLKDDEAKTNYDYY   84 (109)
T ss_dssp             GCCTTSTTTTSCHHHHTTCCGGGCCHHHHHHHHHHHHHHTCGGGCCSHHHHHHHHHHHHHHHHHHHHHHSHHHHHHHHHH
T ss_pred             HHHHHHHcCCCCHHHHcCCCCCCCCHHHHHHHHHHHHHHHCcCCCCCccccHHHHHHHHHHHHHHHHHCCHHHHHHHHHh
Confidence            35677889999999999999999 99999999999999999999986    56789999999999999999999999999


Q ss_pred             ccCCcccccccccccccccCCCCCh
Q 022251           98 IAHPEEVFYNAARYYHAYYGHKTDP  122 (300)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~  122 (300)
                      +.++.+.+.++..||+..+++++++
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~  109 (109)
T 2qsa_A           85 LDHPDQRFYNYYQYYRLRAAPKVDL  109 (109)
T ss_dssp             HHCTTCHHHHHHHHHHHC-------
T ss_pred             ccCchHHHHHHHHHHHHHhccccCC
Confidence            9999988989999999988887763
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 300
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-14
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 3e-14
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-13
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 2e-13
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 3e-13
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 2e-11
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 2e-11
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 4e-10
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 65.5 bits (159), Expect = 2e-14
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 7/77 (9%)

Query: 32  EDDCYDLLGVSQNANSSEIKKAYYKLSLKYHPDKNPD-------PDSRKLFVKIANAYEI 84
           + D Y +LG   +AN S++K+ Y KL L YHPDK           +  + F++I  A++I
Sbjct: 15  KKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKI 74

Query: 85  LKDEATREQYDYAIAHP 101
           L +E T+++YD   + P
Sbjct: 75  LGNEETKKKYDLQRSGP 91
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query300
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.86
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.79
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.75
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.68
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.67
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.66
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.57
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.86  E-value=3.3e-22  Score=146.60  Aligned_cols=70  Identities=41%  Similarity=0.734  Sum_probs=64.7

Q ss_pred             ccccccccCcCCCCCHHHHHHHHHHHHHhhCCCCCCC-cchHHHHHHHHHhhhhccchhHHHhhcccccCC
Q 022251           32 EDDCYDLLGVSQNANSSEIKKAYYKLSLKYHPDKNPD-PDSRKLFVKIANAYEILKDEATREQYDYAIAHP  101 (300)
Q Consensus        32 ~~~~Y~iLgv~~~as~~eIkkayr~la~~~HPDk~~~-~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~  101 (300)
                      .+|||+||||+++||.++||+|||++++++|||++++ +.+.+.|..|++||+||+||.+|..||.+|..+
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~   72 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAA   72 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSS
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccc
Confidence            4799999999999999999999999999999999985 567888999999999999999999999987543
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure