Citrus Sinensis ID: 022276
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 300 | ||||||
| 317106675 | 368 | JHL18I08.12 [Jatropha curcas] | 0.963 | 0.785 | 0.728 | 1e-124 | |
| 224066056 | 367 | predicted protein [Populus trichocarpa] | 0.86 | 0.702 | 0.809 | 1e-123 | |
| 118485796 | 367 | unknown [Populus trichocarpa] | 0.86 | 0.702 | 0.809 | 1e-123 | |
| 118489556 | 367 | unknown [Populus trichocarpa x Populus d | 0.86 | 0.702 | 0.809 | 1e-123 | |
| 118485910 | 367 | unknown [Populus trichocarpa] | 0.823 | 0.673 | 0.828 | 1e-122 | |
| 255538808 | 366 | cysteine protease, putative [Ricinus com | 0.966 | 0.792 | 0.684 | 1e-118 | |
| 356509908 | 366 | PREDICTED: cysteine proteinase RD19a-lik | 0.97 | 0.795 | 0.703 | 1e-118 | |
| 359806140 | 366 | uncharacterized protein LOC100778716 pre | 0.92 | 0.754 | 0.722 | 1e-117 | |
| 124484383 | 369 | cysteine proteinase precursor [Ipomoea n | 0.9 | 0.731 | 0.718 | 1e-115 | |
| 5051468 | 363 | putative preprocysteine proteinase [Nico | 0.896 | 0.741 | 0.732 | 1e-115 |
| >gi|317106675|dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas] | Back alignment and taxonomy information |
|---|
Score = 451 bits (1160), Expect = e-124, Method: Compositional matrix adjust.
Identities = 217/298 (72%), Positives = 255/298 (85%), Gaps = 9/298 (3%)
Query: 3 RLILSSLLLLLLSSVLASAVAVND-DDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFS 61
R ++S L+ LLS +AS + ++ DD +IRQVVP DG+Q DHLLNAEHHF+ FK+KF
Sbjct: 4 RCLISFLVYALLSFTIASTTSPDELDDPLIRQVVP-DGDQ--DHLLNAEHHFTTFKAKFG 60
Query: 62 KTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNRRLR 121
KTYATQEEHDYRF++FKANLRRA++ Q++DPTAVHGVT FSDLTP EFRRQ+LGL RRLR
Sbjct: 61 KTYATQEEHDYRFKLFKANLRRARKHQMMDPTAVHGVTMFSDLTPREFRRQYLGL-RRLR 119
Query: 122 LPADAQKAPILPTNDLPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGEL 181
LPADA +APILPTNDLPTDFDWRDHGAVT VK+QG+CGSCWSFSA GALEGAHFL+TGEL
Sbjct: 120 LPADAHEAPILPTNDLPTDFDWRDHGAVTNVKNQGSCGSCWSFSAAGALEGAHFLATGEL 179
Query: 182 VSLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGS 241
VSLSEQQLVDCDHECDPEE G+CDSGCNGGLM +AFEY LKAGG+ERE+DYPYTG D G
Sbjct: 180 VSLSEQQLVDCDHECDPEEYGACDSGCNGGLMTTAFEYTLKAGGLEREEDYPYTGNDRGP 239
Query: 242 CKFDKSKIAAAVSNFSVISSDEDQMAANLVKHGPLAGNVASIELPHISFSFLFTVSSP 299
CKFD++KI A+VSNFSV+S DEDQ+AANLVKHGPLA + ++ + +++ VS P
Sbjct: 240 CKFDRNKIVASVSNFSVVSIDEDQIAANLVKHGPLAVGINAVFMQ----TYMGGVSCP 293
|
Source: Jatropha curcas Species: Jatropha curcas Genus: Jatropha Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224066056|ref|XP_002302004.1| predicted protein [Populus trichocarpa] gi|222843730|gb|EEE81277.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|118485796|gb|ABK94746.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|118489556|gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides] | Back alignment and taxonomy information |
|---|
| >gi|118485910|gb|ABK94801.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255538808|ref|XP_002510469.1| cysteine protease, putative [Ricinus communis] gi|223551170|gb|EEF52656.1| cysteine protease, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356509908|ref|XP_003523684.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359806140|ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max] gi|255639509|gb|ACU20049.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|124484383|dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil] | Back alignment and taxonomy information |
|---|
| >gi|5051468|emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 300 | ||||||
| TAIR|locus:2130180 | 373 | AT4G16190 [Arabidopsis thalian | 0.813 | 0.654 | 0.778 | 1.2e-104 | |
| TAIR|locus:2120222 | 368 | RD19 "RESPONSIVE TO DEHYDRATIO | 0.83 | 0.676 | 0.736 | 3.1e-99 | |
| TAIR|locus:2050145 | 361 | AT2G21430 [Arabidopsis thalian | 0.826 | 0.686 | 0.718 | 7.4e-98 | |
| TAIR|locus:2082687 | 367 | AT3G54940 [Arabidopsis thalian | 0.83 | 0.678 | 0.533 | 6.1e-71 | |
| DICTYBASE|DDB_G0290957 | 343 | cprA "cysteine proteinase 1" [ | 0.786 | 0.688 | 0.455 | 2.1e-52 | |
| DICTYBASE|DDB_G0291191 | 352 | DDB_G0291191 "cysteine proteas | 0.746 | 0.636 | 0.426 | 1.6e-47 | |
| ZFIN|ZDB-GENE-030131-9831 | 473 | ctsf "cathepsin F" [Danio reri | 0.71 | 0.450 | 0.434 | 3.9e-44 | |
| DICTYBASE|DDB_G0279799 | 376 | cprB "cysteine proteinase 2" [ | 0.77 | 0.614 | 0.400 | 5.2e-42 | |
| UNIPROTKB|Q0VCU3 | 460 | CTSF "Uncharacterized protein" | 0.71 | 0.463 | 0.436 | 2.8e-41 | |
| UNIPROTKB|E2RR02 | 460 | CTSF "Uncharacterized protein" | 0.81 | 0.528 | 0.386 | 7.5e-41 |
| TAIR|locus:2130180 AT4G16190 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1036 (369.7 bits), Expect = 1.2e-104, P = 1.2e-104
Identities = 193/248 (77%), Positives = 221/248 (89%)
Query: 31 IRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLL 90
IRQVVP E++++ LLNAEHHF+LFKSK+ KTYATQ EHD+RFRVFKANLRRA+R QLL
Sbjct: 36 IRQVVP---EENDEQLLNAEHHFTLFKSKYEKTYATQVEHDHRFRVFKANLRRARRNQLL 92
Query: 91 DPTAVHGVTKFSDLTPSEFRRQFLGLNRR-LRLPADAQKAPILPTNDLPTDFDWRDHGAV 149
DP+AVHGVT+FSDLTP EFRR+FLGL RR RLP D Q APILPT+DLPT+FDWR+ GAV
Sbjct: 93 DPSAVHGVTQFSDLTPKEFRRKFLGLKRRGFRLPTDTQTAPILPTSDLPTEFDWREQGAV 152
Query: 150 TGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCDSGCN 209
T VK+QG CGSCWSFSA GALEGAHFL+T ELVSLSEQQLVDCDHECDP ++ SCDSGC+
Sbjct: 153 TPVKNQGMCGSCWSFSAIGALEGAHFLATKELVSLSEQQLVDCDHECDPAQANSCDSGCS 212
Query: 210 GGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAAVSNFSVISSDEDQMAAN 269
GGLMN+AFEY LKAGG+ +E+DYPYTG D +CKFDKSKI A+VSNFSV+SSDEDQ+AAN
Sbjct: 213 GGLMNNAFEYALKAGGLMKEEDYPYTGRDHTACKFDKSKIVASVSNFSVVSSDEDQIAAN 272
Query: 270 LVKHGPLA 277
LV+HGPLA
Sbjct: 273 LVQHGPLA 280
|
|
| TAIR|locus:2120222 RD19 "RESPONSIVE TO DEHYDRATION 19" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2050145 AT2G21430 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082687 AT3G54940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0290957 cprA "cysteine proteinase 1" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291191 DDB_G0291191 "cysteine protease" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-9831 ctsf "cathepsin F" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0279799 cprB "cysteine proteinase 2" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0VCU3 CTSF "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RR02 CTSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 300 | |||
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 2e-70 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 3e-66 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 3e-53 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 2e-48 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 9e-43 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 6e-34 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 4e-23 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 3e-19 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 2e-18 | |
| smart00848 | 57 | smart00848, Inhibitor_I29, Cathepsin propeptide in | 4e-18 | |
| pfam08246 | 58 | pfam08246, Inhibitor_I29, Cathepsin propeptide inh | 2e-15 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 4e-14 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 4e-10 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 2e-07 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 1e-06 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
Score = 217 bits (554), Expect = 2e-70
Identities = 80/158 (50%), Positives = 100/158 (63%), Gaps = 15/158 (9%)
Query: 137 LPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHEC 196
LP FDWR+ GAVT VKDQG CGSCW+FSA GALEG + + TG+LVSLSEQQLVDCD
Sbjct: 1 LPESFDWREKGAVTPVKDQGQCGSCWAFSAVGALEGRYCIKTGKLVSLSEQQLVDCDTGN 60
Query: 197 DPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAA-VSN 255
+ GCNGGL ++AFEYI K GG+ E DYPYT D G+CKF KS A +
Sbjct: 61 N---------GCNGGLPDNAFEYIKKNGGIVTESDYPYTAHD-GTCKFKKSNSKYAKIKG 110
Query: 256 FSVISS-DEDQMAANLVKHGPLAGNVASIELPHISFSF 292
+ + DE+ + A L K+GP++ +I+ F
Sbjct: 111 YGDVPYNDEEALQAALAKNGPVS---VAIDAYEDDFQL 145
|
Length = 213 |
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 300 | |||
| KOG1542 | 372 | consensus Cysteine proteinase Cathepsin F [Posttra | 100.0 | |
| PTZ00203 | 348 | cathepsin L protease; Provisional | 100.0 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 100.0 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 100.0 | |
| KOG1543 | 325 | consensus Cysteine proteinase Cathepsin L [Posttra | 100.0 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 100.0 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 100.0 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 100.0 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 100.0 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 100.0 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 100.0 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 100.0 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 99.97 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 99.97 | |
| KOG1544 | 470 | consensus Predicted cysteine proteinase TIN-ag [Ge | 99.96 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 99.95 | |
| PF08246 | 58 | Inhibitor_I29: Cathepsin propeptide inhibitor doma | 99.66 | |
| smart00848 | 57 | Inhibitor_I29 Cathepsin propeptide inhibitor domai | 99.49 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.36 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 98.68 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 97.68 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 91.43 | |
| KOG4128 | 457 | consensus Bleomycin hydrolases and aminopeptidases | 89.94 | |
| PF08127 | 41 | Propeptide_C1: Peptidase family C1 propeptide; Int | 88.19 |
| >KOG1542 consensus Cysteine proteinase Cathepsin F [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.6e-71 Score=485.26 Aligned_cols=260 Identities=55% Similarity=0.924 Sum_probs=237.5
Q ss_pred CCCCCceeeecCCCCCCcchhhccHHHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHHhcCCCC-CeeeeeccCCC
Q 022276 25 NDDDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDP-TAVHGVTKFSD 103 (300)
Q Consensus 25 ~~~~~~i~~~~~~~i~~~~~~l~~~~~~F~~f~~~~~k~Y~s~~E~~~r~~~F~~n~~~I~~~N~~~~-s~~~giN~FsD 103 (300)
..++..|+++.... +.+...++.+++|..|+.+|+|+|.+.+|+.+|+.+|+.|+..+++++..++ +.++|+|+|||
T Consensus 45 ~~~~~~i~~v~~~~--~~~~~~l~~~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~~d~gsA~yGvtqFSD 122 (372)
T KOG1542|consen 45 LGDDLTIRQVVRLQ--DLNPRGLGLEDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQENDPGSAEYGVTQFSD 122 (372)
T ss_pred cchhhhhhhhhhhc--ccCCcccchHHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhhcCccccccCccchhh
Confidence 45788888887532 2345666779999999999999999999999999999999999999999887 99999999999
Q ss_pred CChhhHHhhhcCCCcc-CCCCCCCCCCCCCCCCCCCCceecCCCCCccccccCCCCcchHHHHHHHHHHHHHHHhcCCCc
Q 022276 104 LTPSEFRRQFLGLNRR-LRLPADAQKAPILPTNDLPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELV 182 (300)
Q Consensus 104 lt~~Ef~~~~~g~~~~-~~~~~~~~~~~~~~~~~lP~s~DwR~~g~v~pvknQg~CgsCwAfa~~~~~e~~~~i~~~~~~ 182 (300)
||++||++++++.+.. .+.+.....++..+...+|++||||++|.||||||||.||||||||+++++|++++|++|+++
T Consensus 123 lT~eEFkk~~l~~~~~~~~~~~~~~~~~~~~~~~lP~~fDWR~kgaVTpVKnQG~CGSCWAFS~tG~vEga~~i~~g~Lv 202 (372)
T KOG1542|consen 123 LTEEEFKKIYLGVKRRGSKLPGDAAEAPIEPGESLPESFDWRDKGAVTPVKNQGMCGSCWAFSTTGAVEGAWAIATGKLV 202 (372)
T ss_pred cCHHHHHHHhhccccccccCccccccCcCCCCCCCCcccchhccCCccccccCCcCcchhhhhhhhhhhhHHHhhcCccc
Confidence 9999999999887763 344444455555677899999999999999999999999999999999999999999999999
Q ss_pred cCChhHHHhhCCCCCCCCCCCCCCCCCCCChHHHHHHHHHhCCcCCCcccccCCCCCCCCCCCCCCceEEEceeEEcChh
Q 022276 183 SLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAAVSNFSVISSD 262 (300)
Q Consensus 183 ~lS~Q~lidC~~~~~~~~~~~~~~gC~GG~~~~a~~y~~~~~G~~~e~~yPY~~~~~~~C~~~~~~~~~~i~~~~~v~~~ 262 (300)
+||||||+||+. +++||+||.+.+||+|+++.+||+.|++|||++.++..|..++...++.|.+|..++.|
T Consensus 203 sLSEQeLvDCD~---------~d~gC~GGl~~nA~~~~~~~gGL~~E~dYPY~g~~~~~C~~~~~~~~v~I~~f~~l~~n 273 (372)
T KOG1542|consen 203 SLSEQELVDCDS---------CDNGCNGGLMDNAFKYIKKAGGLEKEKDYPYTGKKGNQCHFDKSKIVVSIKDFSMLSNN 273 (372)
T ss_pred ccchhhhhcccC---------cCCcCCCCChhHHHHHHHHhCCccccccCCccccCCCccccchhhceEEEeccEecCCC
Confidence 999999999996 59999999999999999888999999999999999459999999999999999999999
Q ss_pred HHHHHHHHHhcCCeEEEEecCCCCCccCeeEec
Q 022276 263 EDQMAANLVKHGPLAGNVASIELPHISFSFLFT 295 (300)
Q Consensus 263 ~~~i~~al~~~GPv~v~i~a~~f~~Y~~Giy~~ 295 (300)
|++|.+.|+++|||+|+|+|..||+|++||..|
T Consensus 274 E~~ia~wLv~~GPi~vgiNa~~mQ~YrgGV~~P 306 (372)
T KOG1542|consen 274 EDQIAAWLVTFGPLSVGINAKPMQFYRGGVSCP 306 (372)
T ss_pred HHHHHHHHHhcCCeEEEEchHHHHHhcccccCC
Confidence 999999999999999999999999999999998
|
|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >KOG1543 consensus Cysteine proteinase Cathepsin L [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >KOG1544 consensus Predicted cysteine proteinase TIN-ag [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4128 consensus Bleomycin hydrolases and aminopeptidases of cysteine protease family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08127 Propeptide_C1: Peptidase family C1 propeptide; InterPro: IPR012599 This domain is found at the N-terminal of cathepsin B and cathepsin B-like peptidases that belong to MEROPS peptidase subfamily C1A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 300 | ||||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 9e-36 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 6e-35 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 8e-35 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 1e-34 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 1e-33 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 8e-30 | ||
| 1icf_A | 175 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 8e-30 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 9e-30 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 9e-30 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 6e-29 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 9e-29 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 1e-28 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 1e-28 | ||
| 1mhw_A | 175 | Design Of Non-covalent Inhibitors Of Human Cathepsi | 1e-28 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 1e-28 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 2e-28 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 3e-28 | ||
| 1pci_A | 322 | Procaricain Length = 322 | 6e-28 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 7e-28 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 1e-27 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 1e-27 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 1e-27 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 2e-27 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 2e-27 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 2e-27 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 4e-27 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 4e-27 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 4e-27 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 4e-27 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 4e-27 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 5e-27 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 5e-27 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 5e-27 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 9e-27 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 1e-26 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 1e-26 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 2e-26 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 2e-26 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 3e-26 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 5e-26 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 7e-26 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 7e-26 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 8e-26 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 1e-25 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 2e-25 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 4e-25 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 1e-24 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 1e-24 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 2e-23 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 2e-23 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 2e-23 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 2e-23 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 2e-23 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 3e-23 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 3e-23 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 3e-23 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 3e-23 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 5e-23 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 2e-22 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 2e-22 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 2e-22 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 3e-22 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 2e-21 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 4e-21 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 8e-21 | ||
| 1meg_A | 216 | Crystal Structure Of A Caricain D158e Mutant In Com | 2e-20 | ||
| 1ppo_A | 216 | Determination Of The Structure Of Papaya Protease O | 2e-20 | ||
| 3bpm_A | 243 | Crystal Structure Of Falcipain-3 With Its Inhibitor | 3e-19 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 3e-18 | ||
| 1gec_E | 216 | Glycyl Endopeptidase-complex With Benzyloxycarbonyl | 4e-18 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 2e-17 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 2e-17 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 4e-17 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 3e-16 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 4e-16 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 4e-16 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 2e-14 | ||
| 1xkg_A | 312 | Crystal Structure Of The Major House Dust Mite Alle | 2e-14 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 2e-13 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 5e-13 | ||
| 1k3b_B | 164 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 1e-11 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 3e-11 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 5e-11 | ||
| 3f5v_A | 222 | C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 | 7e-10 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 1e-09 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 4e-08 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 2e-06 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 3e-06 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 5e-06 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 5e-06 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 6e-06 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 6e-06 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 8e-06 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 8e-06 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 9e-06 | ||
| 3f75_P | 106 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 1e-05 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 3e-05 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 8e-05 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 7e-04 |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
|
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|1PCI|A Chain A, Procaricain Length = 322 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 | Back alignment and structure |
| >pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 | Back alignment and structure |
| >pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|1K3B|B Chain B, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 164 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|3F75|P Chain P, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 106 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 300 | |||
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 1e-106 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 1e-105 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 1e-105 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 1e-103 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 2e-99 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 3e-98 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 1e-95 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 4e-93 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 2e-85 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 5e-82 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 7e-82 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 3e-81 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 2e-80 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 8e-79 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 8e-79 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 2e-78 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 3e-77 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 6e-77 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 7e-77 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 8e-77 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 5e-76 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 6e-76 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 8e-76 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 5e-75 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 7e-74 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 1e-72 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 1e-72 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 7e-72 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 7e-71 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 9e-71 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 2e-70 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 3e-63 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 2e-61 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 2e-53 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 1e-51 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 2e-47 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 2e-47 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 7e-44 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 8e-43 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 9e-27 | |
| 2l95_A | 80 | Crammer, LP06209P; cysteine proteinase inhibitor, | 1e-13 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 7e-13 |
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
Score = 311 bits (799), Expect = e-106
Identities = 82/257 (31%), Positives = 120/257 (46%), Gaps = 19/257 (7%)
Query: 41 QSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVH---- 96
+ L +HH+ L+K + K Y + E R +++ NL+ L +H
Sbjct: 3 HKDPTL---DHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDL 59
Query: 97 GVTKFSDLTPSEFRRQFLGLNRRLRLPADAQKAPILPTNDLPTDFDWRDHGAVTGVKDQG 156
G+ D+T E L + + P LP DWR+ G VT VK QG
Sbjct: 60 GMNHLGDMTSEEVMSLMSSLRVPSQWQRNI-TYKSNPNRILPDSVDWREKGCVTEVKYQG 118
Query: 157 ACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSA 216
+CG+ W+FSA GALE L TG+LVSLS Q LVDC + GCNGG M +A
Sbjct: 119 SCGAAWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCST------EKYGNKGCNGGFMTTA 172
Query: 217 FEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAAVSNFSVISS-DEDQMAANLVKHGP 275
F+YI+ G++ + YPY D C++D AA S ++ + ED + + GP
Sbjct: 173 FQYIIDNKGIDSDASYPYKAMD-QKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGP 231
Query: 276 LAGNVASIELPHISFSF 292
++ V ++ H SF
Sbjct: 232 VS--VG-VDARHPSFFL 245
|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Length = 80 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 300 | |||
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 100.0 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 100.0 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 100.0 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 100.0 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 100.0 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 100.0 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 100.0 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 100.0 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 100.0 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 100.0 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 100.0 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 100.0 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 100.0 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 100.0 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 100.0 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 100.0 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 100.0 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 100.0 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 100.0 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 100.0 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 100.0 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 100.0 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 100.0 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 100.0 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 100.0 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 100.0 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 100.0 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 100.0 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 100.0 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 100.0 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 100.0 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 100.0 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 100.0 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 100.0 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 100.0 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 99.94 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.93 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.84 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 99.76 | |
| 2l95_A | 80 | Crammer, LP06209P; cysteine proteinase inhibitor, | 99.72 |
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-63 Score=454.53 Aligned_cols=242 Identities=33% Similarity=0.623 Sum_probs=213.6
Q ss_pred cHHHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHHhcCC----CCCeeeeeccCCCCChhhHHhhhcCCCccCCCC
Q 022276 48 NAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLL----DPTAVHGVTKFSDLTPSEFRRQFLGLNRRLRLP 123 (300)
Q Consensus 48 ~~~~~F~~f~~~~~k~Y~s~~E~~~r~~~F~~n~~~I~~~N~~----~~s~~~giN~FsDlt~~Ef~~~~~g~~~~~~~~ 123 (300)
..+.+|++|+++|+|.|.+.+|+.+|+.+|++|+++|++||++ +.+|++|+|+|+|||.+||++.+++...+....
T Consensus 17 ~l~~~f~~~~~~~~k~Y~~~~E~~~R~~iF~~N~~~I~~hN~~~~~g~~sy~lg~N~FaDlt~eEf~~~~~~~~~~~~~~ 96 (331)
T 3qj3_A 17 FVAEKWENFKTTYARSYVNAKEETFRKQIFQKKLETFEEHNEKYRQGLVSYTLGVNLFTDMTPEEMKAYTHGLIMPADLH 96 (331)
T ss_dssp HHHHHHHHHHHHTTCCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCSEEECCSTTTTCCHHHHHHHHSCCCCCSSTT
T ss_pred HHHHHHHHHHHHhCCcCCCHHHHHHHHHHHHHHHHHHHHHHhhhccCCCceeecccccccCCHHHHHHHhcccccccccc
Confidence 3567899999999999999899999999999999999999975 679999999999999999999988765431111
Q ss_pred CCCC--CCC----CCCCCCCCCceecCCCCCccccccCCCCcchHHHHHHHHHHHHHHHhcCC--CccCChhHHHhhCCC
Q 022276 124 ADAQ--KAP----ILPTNDLPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGE--LVSLSEQQLVDCDHE 195 (300)
Q Consensus 124 ~~~~--~~~----~~~~~~lP~s~DwR~~g~v~pvknQg~CgsCwAfa~~~~~e~~~~i~~~~--~~~lS~Q~lidC~~~ 195 (300)
.... ..+ .....++|++||||++|+|+||||||.||||||||++++||+++++++|+ .+.||+|+|+||+..
T Consensus 97 ~~~~~~~~~~~~~~~~~~~lP~s~DwR~~g~vtpVkdQg~CGSCWAFaa~~alE~~~~i~~g~~~~~~LSeQ~LvdC~~~ 176 (331)
T 3qj3_A 97 KNGIPIKTREDLGLNASVRYPASFDWRDQGMVSPVKNQGSCGSSWAFSSTGAIESQMKIANGAGYDSSVSEQQLVDCVPN 176 (331)
T ss_dssp TTCEEECSGGGGTCCSSCCCCSSEEGGGGTCSCCCCBCCSSCCHHHHHHHHHHHHHHHHHHCTTSCCCBCHHHHHHHCTT
T ss_pred ccCcccccccccccccccCCCcceecccCCccCCCccCcccchhhHHHHHHHHHHHHHHHhCCCcccCcCHHHHhhhccC
Confidence 0000 000 00224799999999999999999999999999999999999999999998 899999999999974
Q ss_pred CCCCCCCCCCCCCCCCChHHHHHHHHHhCCcCCCcccccCCCCCCCCCCCCCCceEEEceeEEcCh-hHHHHHHHHHhcC
Q 022276 196 CDPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAAVSNFSVISS-DEDQMAANLVKHG 274 (300)
Q Consensus 196 ~~~~~~~~~~~gC~GG~~~~a~~y~~~~~G~~~e~~yPY~~~~~~~C~~~~~~~~~~i~~~~~v~~-~~~~i~~al~~~G 274 (300)
+.||+||++..||+|+++++|+++|++|||.+.+ +.|........++|.+|..++. ++++|+++|+++|
T Consensus 177 ---------~~GC~GG~~~~a~~yi~~~~Gi~~e~~yPY~~~~-~~C~~~~~~~~~~i~~~~~v~~~~e~~lk~al~~~G 246 (331)
T 3qj3_A 177 ---------ALGCSGGWMNDAFTYVAQNGGIDSEGAYPYEMAD-GNCHYDPNQVAARLSGYVYLSGPDENMLADMVATKG 246 (331)
T ss_dssp ---------SCGGGCCCHHHHHHHHHHHTCEEBTTTSCCCSSC-CCCCCCTTSEEECCSEEEEESSCCHHHHHHHHHHHC
T ss_pred ---------CCCCCCCCHHHHHHHHHHcCCcCcccccCccCCC-CCCCCCcccceeEeeEEEEeCCCCHHHHHHHHHhCC
Confidence 8899999999999999999899999999999988 8999888888889999999986 8999999999999
Q ss_pred CeEEEEecCC-CCCccCeeEecCCCC
Q 022276 275 PLAGNVASIE-LPHISFSFLFTVSSP 299 (300)
Q Consensus 275 Pv~v~i~a~~-f~~Y~~Giy~~~~~~ 299 (300)
||+|+|++.. |++|++|||..+.|.
T Consensus 247 PV~v~i~a~~~f~~Y~~Gvy~~~~c~ 272 (331)
T 3qj3_A 247 PVAVAFDADDPFGSYSGGVYYNPTCE 272 (331)
T ss_dssp CEEEEECCCTTGGGEEEEEECCTTCC
T ss_pred CEEEEEEcccccccccCceEeCCCCC
Confidence 9999999976 999999999987663
|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 300 | ||||
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 7e-42 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 1e-38 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 3e-37 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 3e-37 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 7e-36 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 1e-35 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 3e-35 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 4e-35 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 4e-35 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 7e-35 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 9e-35 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 2e-34 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 5e-34 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 2e-33 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 1e-32 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 1e-32 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 1e-32 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 5e-30 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 1e-26 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 3e-24 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 8e-04 |
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin L species: Human (Homo sapiens) [TaxId: 9606]
Score = 144 bits (364), Expect = 7e-42
Identities = 82/231 (35%), Positives = 118/231 (51%), Gaps = 15/231 (6%)
Query: 50 EHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVH----GVTKFSDLT 105
E ++ +K+ ++ Y EE +R V++ N++ + H + F D+T
Sbjct: 9 EAQWTKWKAMHNRLYGMNEEG-WRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMT 67
Query: 106 PSEFRRQFLGLNRRLRLPADAQKAPILPTNDLPTDFDWRDHGAVTGVKDQGACGSCWSFS 165
EFR+ G R + P+ + P DWR+ G VT VK+QG CGSCW+FS
Sbjct: 68 SEEFRQVMNGFQNRKPRKGKVFQEPL--FYEAPRSVDWREKGYVTPVKNQGQCGSCWAFS 125
Query: 166 ATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSAFEYILKAGG 225
ATGALEG F TG L+SLSEQ LVDC + GCNGGLM+ AF+Y+ GG
Sbjct: 126 ATGALEGQMFRKTGRLISLSEQNLVDCSGPQ-------GNEGCNGGLMDYAFQYVQDNGG 178
Query: 226 VEREKDYPYTGTDGGSCKFDKSKIAAAVSNFSVISSDEDQMAANLVKHGPL 276
++ E+ YPY T+ SCK++ A + F I E + + GP+
Sbjct: 179 LDSEESYPYEATE-ESCKYNPKYSVANDAGFVDIPKQEKALMKAVATVGPI 228
|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 300 | |||
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 100.0 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 100.0 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 100.0 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 100.0 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 100.0 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 100.0 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 100.0 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 100.0 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 100.0 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 100.0 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 99.97 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 98.03 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 97.76 |
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin L species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.6e-56 Score=406.03 Aligned_cols=241 Identities=33% Similarity=0.613 Sum_probs=208.4
Q ss_pred cHHHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHHhcCC----CCCeeeeeccCCCCChhhHHhhhcCCCccCCCC
Q 022276 48 NAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLL----DPTAVHGVTKFSDLTPSEFRRQFLGLNRRLRLP 123 (300)
Q Consensus 48 ~~~~~F~~f~~~~~k~Y~s~~E~~~r~~~F~~n~~~I~~~N~~----~~s~~~giN~FsDlt~~Ef~~~~~g~~~~~~~~ 123 (300)
..+.+|++|+++|+|.|.+ +|+.+|+.+|++|++.|++||++ +.+|++|+|+|+|||.+||.+.+++........
T Consensus 7 ~l~~~F~~f~~~~~K~Y~~-~ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~~~~~~ 85 (316)
T d1cs8a_ 7 SLEAQWTKWKAMHNRLYGM-NEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRK 85 (316)
T ss_dssp GGHHHHHHHHHHTTCCCCT-THHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCCCCCSC
T ss_pred HHHHHHHHHHHHhCCcCCC-HHHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhcccccccccc
Confidence 4567899999999999977 56789999999999999999974 469999999999999999999888765432221
Q ss_pred CCCCCCCCCCCCCCCCceecCCCCCccccccCCCCcchHHHHHHHHHHHHHHHhcCCCccCChhHHHhhCCCCCCCCCCC
Q 022276 124 ADAQKAPILPTNDLPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGS 203 (300)
Q Consensus 124 ~~~~~~~~~~~~~lP~s~DwR~~g~v~pvknQg~CgsCwAfa~~~~~e~~~~i~~~~~~~lS~Q~lidC~~~~~~~~~~~ 203 (300)
... .......++|++||||++|+|+||||||.||||||||+++++|++++++++..+.||+|||+||+.. .
T Consensus 86 ~~~--~~~~~~~~lP~s~Dwr~~g~vtpVkdQG~CGsCwAfa~~~~~E~~~~i~~~~~~~lS~Q~lvdC~~~-------~ 156 (316)
T d1cs8a_ 86 GKV--FQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGP-------Q 156 (316)
T ss_dssp CEE--CCCCTTCCCCSCEEGGGGTCCCCCCBCCSSSCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHCGG-------G
T ss_pred Ccc--ccCcccccCCCceECCcCCcccccccCCCCceeeehhhhHHHHHHHHhhcCCcccchhhhhhhcccc-------c
Confidence 111 1122345899999999999999999999999999999999999999999999999999999999864 2
Q ss_pred CCCCCCCCChHHHHHHHHHhCCcCCCcccccCCCCCCCCCCCCCCceEEEceeEEcChhHHHHHHHHHhcCCeEEEEecC
Q 022276 204 CDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAAVSNFSVISSDEDQMAANLVKHGPLAGNVASI 283 (300)
Q Consensus 204 ~~~gC~GG~~~~a~~y~~~~~G~~~e~~yPY~~~~~~~C~~~~~~~~~~i~~~~~v~~~~~~i~~al~~~GPv~v~i~a~ 283 (300)
++.||.||.+..||.|++.+|++..|.+|||.+.. ..|..........+..+.....+++.|+++|+.+|||+|+|++.
T Consensus 157 ~~~~c~gg~~~~a~~y~~~~g~~~~e~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~gpv~v~i~~~ 235 (316)
T d1cs8a_ 157 GNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATE-ESCKYNPKYSVANDAGFVDIPKQEKALMKAVATVGPISVAIDAG 235 (316)
T ss_dssp TCCGGGCBCHHHHHHHHHHHTCEEBTTTSCCCSSC-CCCCCCGGGEEECCCCEEECCSCHHHHHHHHHHHCCEEEEECCC
T ss_pred cCCCCCCCchHHHHHHHHhcCcccccccccccccc-cccccccccccccccccccccCcHHHHHHHHHHhCCeEEEEEec
Confidence 47899999999999999999888999999999988 78877666666777777777778999999999999999999986
Q ss_pred C--CCCccCeeEecCCCC
Q 022276 284 E--LPHISFSFLFTVSSP 299 (300)
Q Consensus 284 ~--f~~Y~~Giy~~~~~~ 299 (300)
. |++|++|||..+.|+
T Consensus 236 ~~~f~~y~~Gi~~~~~c~ 253 (316)
T d1cs8a_ 236 HESFLFYKEGIYFEPDCS 253 (316)
T ss_dssp SHHHHTEEEEEECCTTCC
T ss_pred cchhccccCCcccCCCCC
Confidence 4 999999999988764
|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|