Citrus Sinensis ID: 022283
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 299 | ||||||
| 225441459 | 291 | PREDICTED: nudix hydrolase 23, chloropla | 0.959 | 0.986 | 0.666 | 1e-107 | |
| 255579751 | 296 | mutt/nudix hydrolase, putative [Ricinus | 0.979 | 0.989 | 0.65 | 1e-106 | |
| 297827873 | 283 | hypothetical protein ARALYDRAFT_483292 [ | 0.943 | 0.996 | 0.647 | 1e-102 | |
| 21593406 | 280 | unknown [Arabidopsis thaliana] | 0.916 | 0.978 | 0.633 | 1e-101 | |
| 18405878 | 280 | nudix hydrolase 23 [Arabidopsis thaliana | 0.929 | 0.992 | 0.642 | 1e-100 | |
| 297739830 | 237 | unnamed protein product [Vitis vinifera] | 0.779 | 0.983 | 0.745 | 1e-100 | |
| 449437571 | 306 | PREDICTED: nudix hydrolase 23, chloropla | 0.983 | 0.960 | 0.605 | 1e-99 | |
| 224139790 | 215 | predicted protein [Populus trichocarpa] | 0.658 | 0.916 | 0.802 | 4e-95 | |
| 357509957 | 267 | Nudix hydrolase [Medicago truncatula] gi | 0.698 | 0.782 | 0.746 | 1e-94 | |
| 356503481 | 269 | PREDICTED: nudix hydrolase 23, chloropla | 0.705 | 0.784 | 0.753 | 3e-94 |
| >gi|225441459|ref|XP_002275478.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 393 bits (1009), Expect = e-107, Method: Compositional matrix adjust.
Identities = 202/303 (66%), Positives = 242/303 (79%), Gaps = 16/303 (5%)
Query: 1 MLKSVQILGSSSGFLSLILKKSHNSC-YGLSFVAVSTNPLPYSTARRHEIVSKTDSLVSP 59
MLK++QILGSSS F+S K HNSC + + + S++ P T SLV P
Sbjct: 1 MLKAIQILGSSSVFVSQRWK-YHNSCGFSIISCSCSSSRTPTMT-----------SLVMP 48
Query: 60 AFLTRRTRCFRASRVCATRSESNQDA--TSSHPSSAAVHSAGNVLKISFCQWCGGQTKHE 117
TR+ RCFRA R R+ESN DA +SS SSA+V S G+ LKI+FCQWCGG TKH+
Sbjct: 49 TSPTRKMRCFRAFRASTIRAESNPDAPSSSSASSSASVQSTGSTLKINFCQWCGGPTKHD 108
Query: 118 VPHGEEKMRAICTVCGKIAYQNPKMVVGCLIEHDKKILLCKRKIEPSYGLWTLPAGYMEI 177
+P GEEK+RAICT+CGKI YQNPKMVVGCLI H+ K+LLC+RKI+PSYG WTLPAGY+EI
Sbjct: 109 IPEGEEKIRAICTLCGKITYQNPKMVVGCLIAHENKVLLCQRKIQPSYGRWTLPAGYLEI 168
Query: 178 GESAAEGAIRETWEEARADVEVQSPFAQLDIPRIGQIYIIFLAKLKRPHFSPGPESSECR 237
GESAAEGAIRETWEEA ADVEVQSPFAQLDIP IGQ YIIFL KLK+PHFSPGPES +CR
Sbjct: 169 GESAAEGAIRETWEEAGADVEVQSPFAQLDIPLIGQTYIIFLGKLKKPHFSPGPESLDCR 228
Query: 238 LFALDEIPFDSLAFSSISVTLQLFIDDIR-MGKLNFHYGTINKRPGSSPSDMRAFSLDYH 296
LFALD+IPFDSLAFSS+ VTL+L+I+D++ G+ FHYGTINKRPG+SPSD+++++LD+H
Sbjct: 229 LFALDDIPFDSLAFSSMLVTLKLYIEDVKSTGRPKFHYGTINKRPGTSPSDIQSYTLDFH 288
Query: 297 LQS 299
LQS
Sbjct: 289 LQS 291
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255579751|ref|XP_002530714.1| mutt/nudix hydrolase, putative [Ricinus communis] gi|223529728|gb|EEF31668.1| mutt/nudix hydrolase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297827873|ref|XP_002881819.1| hypothetical protein ARALYDRAFT_483292 [Arabidopsis lyrata subsp. lyrata] gi|297327658|gb|EFH58078.1| hypothetical protein ARALYDRAFT_483292 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|21593406|gb|AAM65373.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18405878|ref|NP_565965.1| nudix hydrolase 23 [Arabidopsis thaliana] gi|68565870|sp|P93740.2|NUD23_ARATH RecName: Full=Nudix hydrolase 23, chloroplastic; Short=AtNUDT23; AltName: Full=ADP-ribose pyrophosphatase; AltName: Full=FAD diphosphatase; Flags: Precursor gi|20198322|gb|AAB63537.2| expressed protein [Arabidopsis thaliana] gi|62320524|dbj|BAD95098.1| hypothetical protein [Arabidopsis thaliana] gi|107738412|gb|ABF83693.1| At2g42070 [Arabidopsis thaliana] gi|330254973|gb|AEC10067.1| nudix hydrolase 23 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297739830|emb|CBI30012.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449437571|ref|XP_004136565.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Cucumis sativus] gi|449511340|ref|XP_004163930.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224139790|ref|XP_002323277.1| predicted protein [Populus trichocarpa] gi|222867907|gb|EEF05038.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357509957|ref|XP_003625267.1| Nudix hydrolase [Medicago truncatula] gi|355500282|gb|AES81485.1| Nudix hydrolase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356503481|ref|XP_003520536.1| PREDICTED: nudix hydrolase 23, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 299 | ||||||
| TAIR|locus:2064632 | 280 | NUDX23 "nudix hydrolase homolo | 0.779 | 0.832 | 0.714 | 1.1e-89 | |
| TIGR_CMR|GSU_2015 | 150 | GSU_2015 "mutT/nudix family pr | 0.207 | 0.413 | 0.469 | 3.3e-09 | |
| TIGR_CMR|BA_3685 | 147 | BA_3685 "mutT/nudix family pro | 0.411 | 0.836 | 0.340 | 7.4e-08 | |
| TIGR_CMR|SPO_0294 | 139 | SPO_0294 "hydrolase, NUDIX fam | 0.351 | 0.755 | 0.283 | 4.5e-07 | |
| TIGR_CMR|BA_1997 | 153 | BA_1997 "mutT/nudix family pro | 0.173 | 0.339 | 0.490 | 5.8e-07 | |
| TIGR_CMR|BA_4380 | 141 | BA_4380 "mutT/nudix family pro | 0.214 | 0.453 | 0.402 | 7.6e-07 | |
| TIGR_CMR|GSU_0154 | 147 | GSU_0154 "mutT/nudix family pr | 0.193 | 0.394 | 0.362 | 5.8e-06 | |
| UNIPROTKB|P0AEI6 | 153 | nudJ "HMP-PP hydrolase /thiami | 0.344 | 0.673 | 0.288 | 1.7e-05 | |
| TIGR_CMR|BA_2047 | 205 | BA_2047 "mutT/nudix family pro | 0.408 | 0.595 | 0.280 | 2.5e-05 | |
| TIGR_CMR|CHY_1339 | 129 | CHY_1339 "mutator mutT protein | 0.274 | 0.635 | 0.305 | 0.00016 |
| TAIR|locus:2064632 NUDX23 "nudix hydrolase homolog 23" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 895 (320.1 bits), Expect = 1.1e-89, P = 1.1e-89
Identities = 168/235 (71%), Positives = 192/235 (81%)
Query: 64 RRTRCFRASRVCATRSESNQDXXXXXXXXXXXXXXGNVLKISFCQWCGGQTKHEVPHGEE 123
RR F+ +R+ ++ S D G+V KI FCQWCGG TKHE+P GEE
Sbjct: 47 RRIFSFKPTRMSSSLPGS--DPVANSPTFVSVQSAGDVRKIKFCQWCGGPTKHEIPDGEE 104
Query: 124 KMRAICTVCGKIAYQNPKMVVGCLIEHDKKILLCKRKIEPSYGLWTLPAGYMEIGESAAE 183
K+RAICT CGKIAYQNPKMVVGCLIEH+ K+LLCKR I+PS+GLWTLPAGY+E+GESAA+
Sbjct: 105 KLRAICTHCGKIAYQNPKMVVGCLIEHEGKVLLCKRNIQPSHGLWTLPAGYLEVGESAAQ 164
Query: 184 GAIRETWEEARADVEVQSPFAQLDIPRIGQIYIIFLAKLKRPHFSPGPESSECRLFALDE 243
GA+RETWEEA A VEV SPFAQLDIP IGQ Y+IFLAKLK HF+PGPES ECRLFALDE
Sbjct: 165 GAMRETWEEAGATVEVISPFAQLDIPLIGQTYVIFLAKLKNLHFAPGPESLECRLFALDE 224
Query: 244 IPFDSLAFSSISVTLQLFIDDIRMGKLNFHYGTINKRPGSSPSDMRAFSLDYHLQ 298
IPFDSLAFSSI VTL L+++D++ GKL FHYGTINKRPGSSPSD+RAFSLDYHLQ
Sbjct: 225 IPFDSLAFSSIYVTLNLYLEDLKKGKLKFHYGTINKRPGSSPSDIRAFSLDYHLQ 279
|
|
| TIGR_CMR|GSU_2015 GSU_2015 "mutT/nudix family protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_3685 BA_3685 "mutT/nudix family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0294 SPO_0294 "hydrolase, NUDIX family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_1997 BA_1997 "mutT/nudix family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4380 BA_4380 "mutT/nudix family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0154 GSU_0154 "mutT/nudix family protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0AEI6 nudJ "HMP-PP hydrolase /thiamin pyrophosphate hydrolase [multifunctional]" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_2047 BA_2047 "mutT/nudix family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1339 CHY_1339 "mutator mutT protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00025387001 | SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (287 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00007090001 | • | 0.495 | |||||||||
| GSVIVG00001049001 | • | 0.400 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 299 | |||
| cd04511 | 130 | cd04511, Nudix_Hydrolase_4, Members of the Nudix h | 2e-79 | |
| COG1051 | 145 | COG1051, COG1051, ADP-ribose pyrophosphatase [Nucl | 1e-27 | |
| cd02883 | 123 | cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup | 1e-20 | |
| cd04672 | 123 | cd04672, Nudix_Hydrolase_14, Members of the Nudix | 2e-20 | |
| cd04673 | 122 | cd04673, Nudix_Hydrolase_15, Members of the Nudix | 2e-19 | |
| pfam00293 | 133 | pfam00293, NUDIX, NUDIX domain | 5e-19 | |
| cd04681 | 130 | cd04681, Nudix_Hydrolase_22, Members of the Nudix | 8e-14 | |
| cd04677 | 132 | cd04677, Nudix_Hydrolase_18, Members of the Nudix | 6e-13 | |
| cd03427 | 137 | cd03427, MTH1, MutT homolog-1 (MTH1) is a member o | 6e-13 | |
| cd04676 | 129 | cd04676, Nudix_Hydrolase_17, Members of the Nudix | 5e-12 | |
| COG2816 | 279 | COG2816, NPY1, NTP pyrophosphohydrolases containin | 1e-10 | |
| cd04680 | 120 | cd04680, Nudix_Hydrolase_21, Members of the Nudix | 6e-10 | |
| cd04678 | 129 | cd04678, Nudix_Hydrolase_19, Members of the Nudix | 2e-09 | |
| cd04679 | 125 | cd04679, Nudix_Hydrolase_20, Members of the Nudix | 5e-09 | |
| cd04669 | 121 | cd04669, Nudix_Hydrolase_11, Members of the Nudix | 6e-09 | |
| cd04684 | 128 | cd04684, Nudix_Hydrolase_25, Contains a crystal st | 6e-09 | |
| cd04699 | 129 | cd04699, Nudix_Hydrolase_39, Members of the Nudix | 7e-09 | |
| cd03673 | 131 | cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate | 1e-08 | |
| cd04674 | 118 | cd04674, Nudix_Hydrolase_16, Members of the Nudix | 1e-08 | |
| COG0494 | 161 | COG0494, MutT, NTP pyrophosphohydrolases including | 2e-08 | |
| cd03425 | 124 | cd03425, MutT_pyrophosphohydrolase, The MutT pyrop | 5e-08 | |
| PRK05379 | 340 | PRK05379, PRK05379, bifunctional nicotinamide mono | 2e-07 | |
| cd03429 | 131 | cd03429, NADH_pyrophosphatase, NADH pyrophosphatas | 2e-07 | |
| PRK00241 | 256 | PRK00241, nudC, NADH pyrophosphatase; Reviewed | 4e-07 | |
| cd04666 | 122 | cd04666, Nudix_Hydrolase_9, Members of the Nudix h | 6e-07 | |
| cd03675 | 134 | cd03675, Nudix_Hydrolase_2, Contains a crystal str | 7e-07 | |
| cd03428 | 130 | cd03428, Ap4A_hydrolase_human_like, Diadenosine te | 8e-07 | |
| cd04671 | 123 | cd04671, Nudix_Hydrolase_13, Members of the Nudix | 9e-07 | |
| cd04688 | 126 | cd04688, Nudix_Hydrolase_29, Members of the Nudix | 1e-06 | |
| cd04694 | 143 | cd04694, Nudix_Hydrolase_35, Members of the Nudix | 1e-06 | |
| cd04682 | 122 | cd04682, Nudix_Hydrolase_23, Members of the Nudix | 2e-06 | |
| cd03671 | 147 | cd03671, Ap4A_hydrolase_plant_like, Diadenosine te | 9e-06 | |
| PLN02325 | 144 | PLN02325, PLN02325, nudix hydrolase | 1e-05 | |
| cd04696 | 125 | cd04696, Nudix_Hydrolase_37, Members of the Nudix | 1e-05 | |
| cd04683 | 120 | cd04683, Nudix_Hydrolase_24, Members of the Nudix | 2e-05 | |
| PRK10546 | 135 | PRK10546, PRK10546, pyrimidine (deoxy)nucleoside t | 2e-05 | |
| cd04667 | 112 | cd04667, Nudix_Hydrolase_10, Members of the Nudix | 2e-05 | |
| cd03424 | 137 | cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase | 6e-05 | |
| cd04700 | 142 | cd04700, DR1025_like, DR1025 from Deinococcus radi | 6e-05 | |
| cd04665 | 118 | cd04665, Nudix_Hydrolase_8, Members of the Nudix h | 1e-04 | |
| cd04670 | 127 | cd04670, Nudix_Hydrolase_12, Members of the Nudix | 1e-04 | |
| cd04664 | 129 | cd04664, Nudix_Hydrolase_7, Members of the Nudix h | 1e-04 | |
| PRK15472 | 141 | PRK15472, PRK15472, nucleoside triphosphatase NudI | 1e-04 | |
| PRK08999 | 312 | PRK08999, PRK08999, hypothetical protein; Provisio | 2e-04 | |
| cd04691 | 117 | cd04691, Nudix_Hydrolase_32, Members of the Nudix | 4e-04 | |
| cd04687 | 128 | cd04687, Nudix_Hydrolase_28, Members of the Nudix | 4e-04 | |
| cd04686 | 131 | cd04686, Nudix_Hydrolase_27, Members of the Nudix | 6e-04 | |
| cd04690 | 118 | cd04690, Nudix_Hydrolase_31, Members of the Nudix | 0.001 | |
| cd03674 | 138 | cd03674, Nudix_Hydrolase_1, Members of the Nudix h | 0.003 | |
| TIGR02705 | 156 | TIGR02705, nudix_YtkD, nucleoside triphosphatase Y | 0.003 | |
| PRK09438 | 148 | PRK09438, nudB, dihydroneopterin triphosphate pyro | 0.003 |
| >gnl|CDD|239948 cd04511, Nudix_Hydrolase_4, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
Score = 236 bits (604), Expect = 2e-79
Identities = 70/130 (53%), Positives = 93/130 (71%)
Query: 129 CTVCGKIAYQNPKMVVGCLIEHDKKILLCKRKIEPSYGLWTLPAGYMEIGESAAEGAIRE 188
C CG I YQNPK++VGC+ E + K+LLC+R IEP +G WTLPAG+ME GE+ +GA+RE
Sbjct: 1 CPDCGYIHYQNPKIIVGCVPEWEGKVLLCRRAIEPRHGFWTLPAGFMENGETTEQGALRE 60
Query: 189 TWEEARADVEVQSPFAQLDIPRIGQIYIIFLAKLKRPHFSPGPESSECRLFALDEIPFDS 248
TWEEA A VE+ +A +P I Q+Y+ + A+L F+PGPES E RLF +EIP+D
Sbjct: 61 TWEEAGARVEIDGLYAVYSVPHISQVYMFYRARLLDLDFAPGPESLEVRLFTEEEIPWDE 120
Query: 249 LAFSSISVTL 258
LAF ++ TL
Sbjct: 121 LAFPTVRRTL 130
|
Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, U=I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. Length = 130 |
| >gnl|CDD|223979 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240029 cd04672, Nudix_Hydrolase_14, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240030 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain | Back alignment and domain information |
|---|
| >gnl|CDD|240037 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240033 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239519 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240032 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|225373 COG2816, NPY1, NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|240036 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240034 cd04678, Nudix_Hydrolase_19, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240035 cd04679, Nudix_Hydrolase_20, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240026 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240040 cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|240054 cd04699, Nudix_Hydrolase_39, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240031 cd04674, Nudix_Hydrolase_16, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239517 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >gnl|CDD|235436 PRK05379, PRK05379, bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239521 cd03429, NADH_pyrophosphatase, NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >gnl|CDD|234699 PRK00241, nudC, NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240024 cd04666, Nudix_Hydrolase_9, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239647 cd03675, Nudix_Hydrolase_2, Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|239520 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240028 cd04671, Nudix_Hydrolase_13, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240044 cd04688, Nudix_Hydrolase_29, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240050 cd04694, Nudix_Hydrolase_35, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240038 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239643 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215184 PLN02325, PLN02325, nudix hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|240052 cd04696, Nudix_Hydrolase_37, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240039 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|182536 PRK10546, PRK10546, pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240025 cd04667, Nudix_Hydrolase_10, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >gnl|CDD|240055 cd04700, DR1025_like, DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >gnl|CDD|240023 cd04665, Nudix_Hydrolase_8, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240027 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240022 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|185369 PRK15472, PRK15472, nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236361 PRK08999, PRK08999, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240047 cd04691, Nudix_Hydrolase_32, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240043 cd04687, Nudix_Hydrolase_28, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240042 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240046 cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239646 cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|131752 TIGR02705, nudix_YtkD, nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >gnl|CDD|236516 PRK09438, nudB, dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 299 | |||
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 100.0 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 100.0 | |
| KOG3084 | 345 | consensus NADH pyrophosphatase I of the Nudix fami | 100.0 | |
| cd04511 | 130 | Nudix_Hydrolase_4 Members of the Nudix hydrolase s | 99.95 | |
| COG1051 | 145 | ADP-ribose pyrophosphatase [Nucleotide transport a | 99.86 | |
| cd04681 | 130 | Nudix_Hydrolase_22 Members of the Nudix hydrolase | 99.85 | |
| PLN02325 | 144 | nudix hydrolase | 99.84 | |
| cd04679 | 125 | Nudix_Hydrolase_20 Members of the Nudix hydrolase | 99.82 | |
| cd03675 | 134 | Nudix_Hydrolase_2 Contains a crystal structure of | 99.82 | |
| PRK15434 | 159 | GDP-mannose mannosyl hydrolase NudD; Provisional | 99.82 | |
| cd03430 | 144 | GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann | 99.82 | |
| cd03429 | 131 | NADH_pyrophosphatase NADH pyrophosphatase, a membe | 99.82 | |
| cd04684 | 128 | Nudix_Hydrolase_25 Contains a crystal structure of | 99.82 | |
| cd03427 | 137 | MTH1 MutT homolog-1 (MTH1) is a member of the Nudi | 99.81 | |
| cd04683 | 120 | Nudix_Hydrolase_24 Members of the Nudix hydrolase | 99.8 | |
| cd04673 | 122 | Nudix_Hydrolase_15 Members of the Nudix hydrolase | 99.8 | |
| cd04696 | 125 | Nudix_Hydrolase_37 Members of the Nudix hydrolase | 99.8 | |
| cd04678 | 129 | Nudix_Hydrolase_19 Members of the Nudix hydrolase | 99.79 | |
| cd04691 | 117 | Nudix_Hydrolase_32 Members of the Nudix hydrolase | 99.79 | |
| cd03673 | 131 | Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy | 99.79 | |
| cd04671 | 123 | Nudix_Hydrolase_13 Members of the Nudix hydrolase | 99.79 | |
| cd04680 | 120 | Nudix_Hydrolase_21 Members of the Nudix hydrolase | 99.79 | |
| cd04672 | 123 | Nudix_Hydrolase_14 Members of the Nudix hydrolase | 99.79 | |
| cd04669 | 121 | Nudix_Hydrolase_11 Members of the Nudix hydrolase | 99.78 | |
| PRK15472 | 141 | nucleoside triphosphatase NudI; Provisional | 99.78 | |
| cd04700 | 142 | DR1025_like DR1025 from Deinococcus radiodurans, a | 99.78 | |
| PRK09438 | 148 | nudB dihydroneopterin triphosphate pyrophosphatase | 99.78 | |
| cd04687 | 128 | Nudix_Hydrolase_28 Members of the Nudix hydrolase | 99.77 | |
| cd04682 | 122 | Nudix_Hydrolase_23 Members of the Nudix hydrolase | 99.77 | |
| cd03674 | 138 | Nudix_Hydrolase_1 Members of the Nudix hydrolase s | 99.76 | |
| PRK10546 | 135 | pyrimidine (deoxy)nucleoside triphosphate pyrophos | 99.75 | |
| cd04677 | 132 | Nudix_Hydrolase_18 Members of the Nudix hydrolase | 99.74 | |
| cd04690 | 118 | Nudix_Hydrolase_31 Members of the Nudix hydrolase | 99.74 | |
| cd03671 | 147 | Ap4A_hydrolase_plant_like Diadenosine tetraphospha | 99.74 | |
| cd04664 | 129 | Nudix_Hydrolase_7 Members of the Nudix hydrolase s | 99.74 | |
| cd04699 | 129 | Nudix_Hydrolase_39 Members of the Nudix hydrolase | 99.74 | |
| cd03424 | 137 | ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) | 99.74 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.73 | |
| cd04676 | 129 | Nudix_Hydrolase_17 Members of the Nudix hydrolase | 99.73 | |
| cd04688 | 126 | Nudix_Hydrolase_29 Members of the Nudix hydrolase | 99.73 | |
| cd04670 | 127 | Nudix_Hydrolase_12 Members of the Nudix hydrolase | 99.73 | |
| cd04674 | 118 | Nudix_Hydrolase_16 Members of the Nudix hydrolase | 99.73 | |
| cd03672 | 145 | Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt | 99.72 | |
| PRK10776 | 129 | nucleoside triphosphate pyrophosphohydrolase; Prov | 99.72 | |
| cd04689 | 125 | Nudix_Hydrolase_30 Members of the Nudix hydrolase | 99.72 | |
| cd04667 | 112 | Nudix_Hydrolase_10 Members of the Nudix hydrolase | 99.72 | |
| cd03425 | 124 | MutT_pyrophosphohydrolase The MutT pyrophosphohydr | 99.71 | |
| cd03428 | 130 | Ap4A_hydrolase_human_like Diadenosine tetraphospha | 99.71 | |
| TIGR00586 | 128 | mutt mutator mutT protein. All proteins in this fa | 99.69 | |
| cd04661 | 132 | MRP_L46 Mitochondrial ribosomal protein L46 (MRP L | 99.69 | |
| PRK00714 | 156 | RNA pyrophosphohydrolase; Reviewed | 99.69 | |
| cd04695 | 131 | Nudix_Hydrolase_36 Members of the Nudix hydrolase | 99.69 | |
| cd04693 | 127 | Nudix_Hydrolase_34 Members of the Nudix hydrolase | 99.68 | |
| cd03426 | 157 | CoAse Coenzyme A pyrophosphatase (CoAse), a member | 99.68 | |
| cd04697 | 126 | Nudix_Hydrolase_38 Members of the Nudix hydrolase | 99.68 | |
| cd04666 | 122 | Nudix_Hydrolase_9 Members of the Nudix hydrolase s | 99.66 | |
| PF00293 | 134 | NUDIX: NUDIX domain; InterPro: IPR000086 The gener | 99.66 | |
| PRK15393 | 180 | NUDIX hydrolase YfcD; Provisional | 99.66 | |
| cd04686 | 131 | Nudix_Hydrolase_27 Members of the Nudix hydrolase | 99.64 | |
| cd02885 | 165 | IPP_Isomerase Isopentenyl diphosphate (IPP) isomer | 99.62 | |
| cd04692 | 144 | Nudix_Hydrolase_33 Members of the Nudix hydrolase | 99.62 | |
| PRK11762 | 185 | nudE adenosine nucleotide hydrolase NudE; Provisio | 99.62 | |
| cd04665 | 118 | Nudix_Hydrolase_8 Members of the Nudix hydrolase s | 99.61 | |
| cd02883 | 123 | Nudix_Hydrolase Nudix hydrolase is a superfamily o | 99.6 | |
| cd04694 | 143 | Nudix_Hydrolase_35 Members of the Nudix hydrolase | 99.58 | |
| PRK03759 | 184 | isopentenyl-diphosphate delta-isomerase; Provision | 99.56 | |
| PRK10729 | 202 | nudF ADP-ribose pyrophosphatase NudF; Provisional | 99.53 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 99.53 | |
| cd04685 | 133 | Nudix_Hydrolase_26 Members of the Nudix hydrolase | 99.52 | |
| TIGR00052 | 185 | nudix-type nucleoside diphosphatase, YffH/AdpP fam | 99.51 | |
| TIGR02150 | 158 | IPP_isom_1 isopentenyl-diphosphate delta-isomerase | 99.51 | |
| PRK10707 | 190 | putative NUDIX hydrolase; Provisional | 99.49 | |
| TIGR02705 | 156 | nudix_YtkD nucleoside triphosphatase YtkD. The fun | 99.48 | |
| cd04662 | 126 | Nudix_Hydrolase_5 Members of the Nudix hydrolase s | 99.46 | |
| cd03670 | 186 | ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) | 99.45 | |
| cd03676 | 180 | Nudix_hydrolase_3 Members of the Nudix hydrolase s | 99.41 | |
| PRK15009 | 191 | GDP-mannose pyrophosphatase NudK; Provisional | 99.37 | |
| cd04663 | 126 | Nudix_Hydrolase_6 Members of the Nudix hydrolase s | 99.34 | |
| PLN02709 | 222 | nudix hydrolase | 99.33 | |
| COG0494 | 161 | MutT NTP pyrophosphohydrolases including oxidative | 99.22 | |
| PLN02552 | 247 | isopentenyl-diphosphate delta-isomerase | 99.2 | |
| PLN03143 | 291 | nudix hydrolase; Provisional | 99.15 | |
| cd03431 | 118 | DNA_Glycosylase_C DNA glycosylase (MutY in bacteri | 99.11 | |
| KOG2839 | 145 | consensus Diadenosine and diphosphoinositol polyph | 99.06 | |
| PLN02791 | 770 | Nudix hydrolase homolog | 98.94 | |
| KOG3041 | 225 | consensus Nucleoside diphosphate-sugar hydrolase o | 98.91 | |
| PF14803 | 34 | Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. | 98.82 | |
| KOG3069 | 246 | consensus Peroxisomal NUDIX hydrolase [Replication | 98.76 | |
| PF14815 | 114 | NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 | 98.7 | |
| PF09297 | 32 | zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do | 98.63 | |
| COG4119 | 161 | Predicted NTP pyrophosphohydrolase [DNA replicatio | 98.58 | |
| KOG0648 | 295 | consensus Predicted NUDIX hydrolase FGF-2 and rela | 98.47 | |
| COG1443 | 185 | Idi Isopentenyldiphosphate isomerase [Lipid metabo | 98.05 | |
| PLN02839 | 372 | nudix hydrolase | 98.04 | |
| smart00661 | 52 | RPOL9 RNA polymerase subunit 9. | 97.47 | |
| KOG2937 | 348 | consensus Decapping enzyme complex, predicted pyro | 97.19 | |
| KOG4195 | 275 | consensus Transient receptor potential-related cha | 97.15 | |
| PRK00432 | 50 | 30S ribosomal protein S27ae; Validated | 97.08 | |
| PRK10880 | 350 | adenine DNA glycosylase; Provisional | 97.01 | |
| COG1998 | 51 | RPS31 Ribosomal protein S27AE [Translation, riboso | 96.95 | |
| COG4112 | 203 | Predicted phosphoesterase (MutT family) [General f | 96.86 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 95.83 | |
| PF02150 | 35 | RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I | 95.2 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 94.96 | |
| PF07754 | 24 | DUF1610: Domain of unknown function (DUF1610); Int | 94.73 | |
| PF13869 | 188 | NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B | 94.72 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 93.83 | |
| PRK13910 | 289 | DNA glycosylase MutY; Provisional | 93.62 | |
| PF06677 | 41 | Auto_anti-p27: Sjogren's syndrome/scleroderma auto | 93.47 | |
| PRK00420 | 112 | hypothetical protein; Validated | 93.18 | |
| TIGR00686 | 109 | phnA alkylphosphonate utilization operon protein P | 92.64 | |
| COG1645 | 131 | Uncharacterized Zn-finger containing protein [Gene | 92.62 | |
| KOG4548 | 263 | consensus Mitochondrial ribosomal protein L17 [Tra | 91.8 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 91.8 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 91.48 | |
| COG1594 | 113 | RPB9 DNA-directed RNA polymerase, subunit M/Transc | 91.38 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 91.08 | |
| PF07282 | 69 | OrfB_Zn_ribbon: Putative transposase DNA-binding d | 91.08 | |
| PF06044 | 254 | DRP: Dam-replacing family; InterPro: IPR010324 Dam | 90.9 | |
| KOG1689 | 221 | consensus mRNA cleavage factor I subunit [RNA proc | 90.78 | |
| PF09296 | 98 | NUDIX-like: NADH pyrophosphatase-like rudimentary | 90.69 | |
| PF13453 | 41 | zf-TFIIB: Transcription factor zinc-finger | 90.6 | |
| PRK10220 | 111 | hypothetical protein; Provisional | 90.6 | |
| PHA00626 | 59 | hypothetical protein | 90.58 | |
| TIGR01384 | 104 | TFS_arch transcription factor S, archaeal. There h | 89.71 | |
| PF08274 | 30 | PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 | 89.5 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 89.31 | |
| KOG0142 | 225 | consensus Isopentenyl pyrophosphate:dimethylallyl | 88.95 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 88.67 | |
| PRK00464 | 154 | nrdR transcriptional regulator NrdR; Validated | 88.41 | |
| PF09862 | 113 | DUF2089: Protein of unknown function (DUF2089); In | 88.25 | |
| PF03119 | 28 | DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f | 87.33 | |
| COG1996 | 49 | RPC10 DNA-directed RNA polymerase, subunit RPC10 ( | 87.02 | |
| PF13717 | 36 | zinc_ribbon_4: zinc-ribbon domain | 86.89 | |
| PF08271 | 43 | TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 | 86.26 | |
| COG2824 | 112 | PhnA Uncharacterized Zn-ribbon-containing protein | 86.2 | |
| smart00659 | 44 | RPOLCX RNA polymerase subunit CX. present in RNA p | 86.18 | |
| COG4640 | 465 | Predicted membrane protein [Function unknown] | 86.17 | |
| PF14353 | 128 | CpXC: CpXC protein | 86.16 | |
| PF13719 | 37 | zinc_ribbon_5: zinc-ribbon domain | 86.07 | |
| COG1194 | 342 | MutY A/G-specific DNA glycosylase [DNA replication | 85.97 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 85.78 | |
| KOG2906 | 105 | consensus RNA polymerase III subunit C11 [Transcri | 85.72 | |
| TIGR02300 | 129 | FYDLN_acid conserved hypothetical protein TIGR0230 | 85.69 | |
| PF12760 | 46 | Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int | 85.26 | |
| PF07295 | 146 | DUF1451: Protein of unknown function (DUF1451); In | 85.13 | |
| PF08772 | 73 | NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon lik | 84.61 | |
| PF09889 | 59 | DUF2116: Uncharacterized protein containing a Zn-r | 84.38 | |
| COG3677 | 129 | Transposase and inactivated derivatives [DNA repli | 84.35 | |
| PF14205 | 55 | Cys_rich_KTR: Cysteine-rich KTR | 84.19 | |
| TIGR01206 | 54 | lysW lysine biosynthesis protein LysW. This very s | 83.95 | |
| COG1571 | 421 | Predicted DNA-binding protein containing a Zn-ribb | 83.86 | |
| PRK11032 | 160 | hypothetical protein; Provisional | 83.81 | |
| PRK12286 | 57 | rpmF 50S ribosomal protein L32; Reviewed | 83.52 | |
| smart00834 | 41 | CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C | 83.46 | |
| COG1997 | 89 | RPL43A Ribosomal protein L37AE/L43A [Translation, | 82.88 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 82.84 | |
| PF03604 | 32 | DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa | 82.21 | |
| PRK14559 | 645 | putative protein serine/threonine phosphatase; Pro | 82.19 | |
| PRK13844 | 200 | recombination protein RecR; Provisional | 81.79 | |
| TIGR01031 | 55 | rpmF_bact ribosomal protein L32. This protein desc | 81.79 | |
| PF09723 | 42 | Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 | 81.78 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 81.24 | |
| PRK11827 | 60 | hypothetical protein; Provisional | 81.14 | |
| COG1779 | 201 | C4-type Zn-finger protein [General function predic | 81.08 | |
| TIGR01084 | 275 | mutY A/G-specific adenine glycosylase. This equiva | 80.45 |
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-44 Score=331.13 Aligned_cols=171 Identities=23% Similarity=0.338 Sum_probs=164.2
Q ss_pred cccceeccccccC-CCCCCcchHHHHHHHHhhhhcCCCCcCCCCCCcccccCCCCcceeecCCCCceeecCCcEEEEEEE
Q 022283 70 RASRVCATRSESN-QDATSSHPSSAAVHSAGNVLKISFCQWCGGQTKHEVPHGEEKMRAICTVCGKIAYQNPKMVVGCLI 148 (299)
Q Consensus 70 ~~~~~~~~r~~~~-~~~~~~~~~~~a~~l~~w~~~~~fC~~CG~~~~~~~~~~~~~~~~~C~~Cg~~~y~~p~~vV~~iv 148 (299)
.++++.++|+++. +|..++.++++|+||++|+++|+|||+||++|... +++++++|++||..+||+++|+|++++
T Consensus 76 ~~~~~~~lR~l~~~~~~~~~~~~~~a~~l~~w~~~~RFCg~CG~~~~~~----~~g~~~~C~~cg~~~fPR~dP~vIv~v 151 (279)
T COG2816 76 EPFELVDLRSLLTELDEGLFGLAARAVQLLEWYRSHRFCGRCGTKTYPR----EGGWARVCPKCGHEHFPRIDPCVIVAV 151 (279)
T ss_pred CccceeeHHHHhccCCHHHHHHHHHHHHHHHHHhhCcCCCCCCCcCccc----cCceeeeCCCCCCccCCCCCCeEEEEE
Confidence 5778999999886 99999999999999999999999999999999998 789999999999999999999999999
Q ss_pred eeCCEEEEEEeecCCCCCceeeceEEeeCCCCHHHHHHHHHHHHhCCceeeccceeeeecCCCCEEEEEEEEEecCCCCC
Q 022283 149 EHDKKILLCKRKIEPSYGLWTLPAGYMEIGESAAEGAIRETWEEARADVEVQSPFAQLDIPRIGQIYIIFLAKLKRPHFS 228 (299)
Q Consensus 149 ~~~~kILL~rr~~~p~~g~w~lPgG~VE~GEs~eeAa~REv~EEtGl~v~~~~~~~~~~~p~~~~~~~~f~a~~~~~~~~ 228 (299)
.+++++||.++.+++ +|+|++.+||||+|||+|+|++||++||+||+|++++|+++|+||+++++|++|.+++.++++.
T Consensus 152 ~~~~~ilLa~~~~h~-~g~yS~LAGFVE~GETlE~AV~REv~EE~Gi~V~~vrY~~SQPWPfP~SLMigf~aey~sgeI~ 230 (279)
T COG2816 152 IRGDEILLARHPRHF-PGMYSLLAGFVEPGETLEQAVAREVFEEVGIKVKNVRYVGSQPWPFPHSLMLGFMAEYDSGEIT 230 (279)
T ss_pred ecCCceeecCCCCCC-CcceeeeeecccCCccHHHHHHHHHHHhhCeEEeeeeEEeccCCCCchhhhhhheeeecccccc
Confidence 999999999999887 8999999999999999999999999999999999999999999999999999999999999988
Q ss_pred CC-CcceeeEEecCCC-CC
Q 022283 229 PG-PESSECRLFALDE-IP 245 (299)
Q Consensus 229 ~~-~E~~~~~W~~~de-L~ 245 (299)
++ .|+.|++||+.+| ++
T Consensus 231 ~d~~Eleda~WFs~~evl~ 249 (279)
T COG2816 231 PDEGELEDARWFSRDEVLP 249 (279)
T ss_pred CCcchhhhccccCHhHHhh
Confidence 88 7999999999999 55
|
|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02325 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional | Back alignment and domain information |
|---|
| >cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15472 nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >TIGR00586 mutt mutator mutT protein | Back alignment and domain information |
|---|
| >cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK00714 RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] | Back alignment and domain information |
|---|
| >PRK15393 NUDIX hydrolase YfcD; Provisional | Back alignment and domain information |
|---|
| >cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >PRK10707 putative NUDIX hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P | Back alignment and domain information |
|---|
| >cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15009 GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02709 nudix hydrolase | Back alignment and domain information |
|---|
| >COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >PLN02552 isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
| >PLN03143 nudix hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02791 Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C | Back alignment and domain information |
|---|
| >KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A | Back alignment and domain information |
|---|
| >PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains | Back alignment and domain information |
|---|
| >COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02839 nudix hydrolase | Back alignment and domain information |
|---|
| >smart00661 RPOL9 RNA polymerase subunit 9 | Back alignment and domain information |
|---|
| >KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00432 30S ribosomal protein S27ae; Validated | Back alignment and domain information |
|---|
| >PRK10880 adenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species | Back alignment and domain information |
|---|
| >PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >PRK13910 DNA glycosylase MutY; Provisional | Back alignment and domain information |
|---|
| >PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) | Back alignment and domain information |
|---|
| >PRK00420 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00686 phnA alkylphosphonate utilization operon protein PhnA | Back alignment and domain information |
|---|
| >COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4548 consensus Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
| >PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins | Back alignment and domain information |
|---|
| >PF06044 DRP: Dam-replacing family; InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements | Back alignment and domain information |
|---|
| >KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF09296 NUDIX-like: NADH pyrophosphatase-like rudimentary NUDIX domain; InterPro: IPR015375 This entry represents the N-terminal domain found in NADH pyrophosphatase | Back alignment and domain information |
|---|
| >PF13453 zf-TFIIB: Transcription factor zinc-finger | Back alignment and domain information |
|---|
| >PRK10220 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA00626 hypothetical protein | Back alignment and domain information |
|---|
| >TIGR01384 TFS_arch transcription factor S, archaeal | Back alignment and domain information |
|---|
| >PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >PRK00464 nrdR transcriptional regulator NrdR; Validated | Back alignment and domain information |
|---|
| >PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins | Back alignment and domain information |
|---|
| >PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] | Back alignment and domain information |
|---|
| >PF13717 zinc_ribbon_4: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00659 RPOLCX RNA polymerase subunit CX | Back alignment and domain information |
|---|
| >COG4640 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14353 CpXC: CpXC protein | Back alignment and domain information |
|---|
| >PF13719 zinc_ribbon_5: zinc-ribbon domain | Back alignment and domain information |
|---|
| >COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2906 consensus RNA polymerase III subunit C11 [Transcription] | Back alignment and domain information |
|---|
| >TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 | Back alignment and domain information |
|---|
| >PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc | Back alignment and domain information |
|---|
| >PF07295 DUF1451: Protein of unknown function (DUF1451); InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length | Back alignment and domain information |
|---|
| >PF08772 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon like; InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1 | Back alignment and domain information |
|---|
| >PF09889 DUF2116: Uncharacterized protein containing a Zn-ribbon (DUF2116); InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown | Back alignment and domain information |
|---|
| >COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF14205 Cys_rich_KTR: Cysteine-rich KTR | Back alignment and domain information |
|---|
| >TIGR01206 lysW lysine biosynthesis protein LysW | Back alignment and domain information |
|---|
| >COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11032 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12286 rpmF 50S ribosomal protein L32; Reviewed | Back alignment and domain information |
|---|
| >smart00834 CxxC_CXXC_SSSS Putative regulatory protein | Back alignment and domain information |
|---|
| >COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates | Back alignment and domain information |
|---|
| >PRK14559 putative protein serine/threonine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13844 recombination protein RecR; Provisional | Back alignment and domain information |
|---|
| >TIGR01031 rpmF_bact ribosomal protein L32 | Back alignment and domain information |
|---|
| >PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11827 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1779 C4-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01084 mutY A/G-specific adenine glycosylase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 299 | ||||
| 3cng_A | 189 | Crystal Structure Of Nudix Hydrolase From Nitrosomo | 2e-40 | ||
| 3o8s_A | 206 | Crystal Structure Of An Adp-Ribose Pyrophosphatase | 2e-11 | ||
| 3q4i_A | 205 | Crystal Structure Of Cdp-Chase In Complex With Gd3+ | 2e-06 | ||
| 3q1p_A | 205 | Crystal Structure Of Cdp-Chase Length = 205 | 3e-06 | ||
| 2qjt_B | 352 | Crystal Structure Of A Bifunctional Nmn Adenylyltra | 1e-05 | ||
| 2fml_A | 273 | Crystal Structure Of MuttNUDIX FAMILY PROTEIN FROM | 2e-05 | ||
| 3dku_A | 153 | Crystal Structure Of Nudix Hydrolase Orf153, Ymfb, | 9e-05 | ||
| 3fk9_A | 188 | Crystal Structure Of Mmutator Mutt Protein From Bac | 2e-04 | ||
| 1vc8_A | 126 | Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydr | 3e-04 | ||
| 3i7u_A | 134 | Crystal Structure Of Ap4a Hydrolase (Aq_158) From A | 5e-04 | ||
| 3smd_A | 153 | Crystal Structure Of A MutNUDIX FAMILY PROTEIN FROM | 5e-04 | ||
| 1vc9_A | 126 | Crystal Structure Of A T.thermophilus Hb8 Ap6a Hydr | 6e-04 |
| >pdb|3CNG|A Chain A, Crystal Structure Of Nudix Hydrolase From Nitrosomonas Europaea Length = 189 | Back alignment and structure |
|
| >pdb|3O8S|A Chain A, Crystal Structure Of An Adp-Ribose Pyrophosphatase (Ssu98_1448) From Streptococcus Suis 89-1591 At 2.27 A Resolution Length = 206 | Back alignment and structure |
| >pdb|3Q4I|A Chain A, Crystal Structure Of Cdp-Chase In Complex With Gd3+ Length = 205 | Back alignment and structure |
| >pdb|3Q1P|A Chain A, Crystal Structure Of Cdp-Chase Length = 205 | Back alignment and structure |
| >pdb|2QJT|B Chain B, Crystal Structure Of A Bifunctional Nmn AdenylyltransferaseADP RIBOSE PYROPHOSPHATASE COMPLEXED With Amp And Mn Ion From Francisella Tularensis Length = 352 | Back alignment and structure |
| >pdb|2FML|A Chain A, Crystal Structure Of MuttNUDIX FAMILY PROTEIN FROM ENTEROCOCCUS Faecalis Length = 273 | Back alignment and structure |
| >pdb|3DKU|A Chain A, Crystal Structure Of Nudix Hydrolase Orf153, Ymfb, From Escherichia Coli K-1 Length = 153 | Back alignment and structure |
| >pdb|3FK9|A Chain A, Crystal Structure Of Mmutator Mutt Protein From Bacillus Halodurans Length = 188 | Back alignment and structure |
| >pdb|1VC8|A Chain A, Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydrolase Ndx1-Ap6a Complex Length = 126 | Back alignment and structure |
| >pdb|3I7U|A Chain A, Crystal Structure Of Ap4a Hydrolase (Aq_158) From Aquifex Aeolicus Vf5 Length = 134 | Back alignment and structure |
| >pdb|3SMD|A Chain A, Crystal Structure Of A MutNUDIX FAMILY PROTEIN FROM BACILLUS Thuringiensis Length = 153 | Back alignment and structure |
| >pdb|1VC9|A Chain A, Crystal Structure Of A T.thermophilus Hb8 Ap6a Hydrolase E50q Mutant- Mg2+-atp Complex Length = 126 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 299 | |||
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 5e-80 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 6e-54 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 2e-52 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 3e-39 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 4e-38 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 1e-37 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 2e-36 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 3e-30 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 4e-29 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 7e-28 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 5e-24 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 3e-22 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 2e-21 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 2e-20 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 3e-20 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 4e-19 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 9e-19 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 2e-18 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 3e-18 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 3e-18 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 6e-18 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 7e-18 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 8e-18 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 3e-17 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 4e-17 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 4e-16 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 6e-16 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 1e-15 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 2e-15 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 4e-15 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 3e-14 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 6e-14 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 1e-13 | |
| 1xsa_A | 153 | BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, | 2e-13 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 4e-13 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 6e-12 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 1e-11 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 1e-10 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 2e-10 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 2e-10 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 2e-10 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 3e-10 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 4e-10 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 5e-10 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 6e-10 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 9e-10 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 8e-09 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 3e-07 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 1e-05 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 1e-05 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 9e-05 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 1e-04 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 3e-04 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 5e-04 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 6e-04 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 7e-04 |
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Length = 189 | Back alignment and structure |
|---|
Score = 239 bits (612), Expect = 5e-80
Identities = 84/182 (46%), Positives = 112/182 (61%)
Query: 106 FCQWCGGQTKHEVPHGEEKMRAICTVCGKIAYQNPKMVVGCLIEHDKKILLCKRKIEPSY 165
FC CGG+ +P G+ R IC C I YQNPK++VGC+ E + K+LLCKR I P
Sbjct: 5 FCSQCGGEVILRIPEGDTLPRYICPKCHTIHYQNPKVIVGCIPEWENKVLLCKRAIAPYR 64
Query: 166 GLWTLPAGYMEIGESAAEGAIRETWEEARADVEVQSPFAQLDIPRIGQIYIIFLAKLKRP 225
G WTLPAG+ME E+ +GA RET EEA A VE++ +A +P I Q+Y++F AKL
Sbjct: 65 GKWTLPAGFMENNETLVQGAARETLEEANARVEIRELYAVYSLPHISQVYMLFRAKLLDL 124
Query: 226 HFSPGPESSECRLFALDEIPFDSLAFSSISVTLQLFIDDIRMGKLNFHYGTINKRPGSSP 285
F PG ES E RLF EIP++ +AF I L+ ++++ G+ FH G INK S
Sbjct: 125 DFFPGIESLEVRLFGEQEIPWNDIAFRVIHDPLKRYMEERHHGQPAFHLGIINKPQAGSN 184
Query: 286 SD 287
S+
Sbjct: 185 SN 186
|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Length = 206 | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Length = 205 | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Length = 139 | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Length = 176 | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Length = 341 | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163 | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Length = 187 | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161 | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156 | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154 | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Length = 155 | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352 | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Length = 269 | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Length = 273 | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194 | Back alignment and structure |
|---|
| >1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Length = 159 | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Length = 140 | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Length = 226 | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Length = 153 | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149 | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197 | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Length = 158 | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Length = 240 | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} Length = 144 | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Length = 321 | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Length = 150 | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194 | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Length = 164 | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Length = 165 | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 299 | |||
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 100.0 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 100.0 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.91 | |
| 3i7u_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.87 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 99.87 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 99.87 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 99.86 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.85 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 99.84 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 99.84 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 99.84 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 99.83 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 99.83 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 99.83 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 99.82 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.82 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 99.82 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 99.81 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 99.81 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 99.8 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 99.8 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 99.8 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 99.8 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 99.79 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 99.79 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 99.79 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 99.79 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 99.79 | |
| 3u53_A | 155 | BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; | 99.79 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 99.79 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 99.79 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 99.79 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 99.78 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 99.77 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 99.77 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 99.77 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 99.77 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 99.77 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 99.76 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 99.76 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 99.76 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 99.75 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 99.75 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 99.75 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 99.74 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 99.74 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 99.74 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 99.71 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 99.71 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 99.71 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 99.7 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 99.7 | |
| 3e57_A | 211 | Uncharacterized protein TM1382; structural genomic | 99.7 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 99.69 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 99.69 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 99.69 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 99.68 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 99.68 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 99.67 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 99.67 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 99.66 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 99.66 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 99.65 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 99.65 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 99.64 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.63 | |
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 99.63 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 99.61 | |
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 99.6 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 99.56 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 99.56 | |
| 2dho_A | 235 | Isopentenyl-diphosphate delta-isomerase 1; alpha/b | 99.43 | |
| 2pny_A | 246 | Isopentenyl-diphosphate delta-isomerase 2; caroten | 99.43 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 99.22 | |
| 3qsj_A | 232 | Nudix hydrolase; structural genomics, PSI-biology, | 99.2 | |
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 99.05 | |
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 98.88 | |
| 3j20_Y | 50 | 30S ribosomal protein S27AE; archaea, archaeal, KI | 97.59 | |
| 3h0g_I | 113 | DNA-directed RNA polymerases I, II, and III subuni | 96.35 | |
| 2k4x_A | 55 | 30S ribosomal protein S27AE; metal-binding, ribonu | 96.15 | |
| 3qt1_I | 133 | DNA-directed RNA polymerases I, II, and III subun; | 94.3 | |
| 4esj_A | 257 | Type-2 restriction enzyme DPNI; restriction endonu | 93.14 | |
| 1twf_I | 122 | B12.6, DNA-directed RNA polymerase II 14.2 kDa pol | 92.15 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 89.22 | |
| 2hf1_A | 68 | Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A | 88.7 | |
| 2jr6_A | 68 | UPF0434 protein NMA0874; solution, structural geno | 88.51 | |
| 2js4_A | 70 | UPF0434 protein BB2007; NESG, northeast structural | 88.26 | |
| 2pk7_A | 69 | Uncharacterized protein; NESG, PLR1, putative tetr | 86.36 | |
| 1vq8_Z | 83 | 50S ribosomal protein L37AE; ribosome 50S, protein | 85.68 | |
| 1dl6_A | 58 | Transcription factor II B (TFIIB); zinc ribbon, ge | 85.19 | |
| 1twf_L | 70 | ABC10-alpha, DNA-directed RNA polymerases I, II, a | 83.81 | |
| 2akl_A | 138 | PHNA-like protein PA0128; two domains, Zn binding | 83.27 | |
| 2jny_A | 67 | Uncharacterized BCR; structure, CGR1, NESG, struct | 82.01 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 80.52 | |
| 1gh9_A | 71 | 8.3 kDa protein (gene MTH1184); beta+alpha complex | 80.07 | |
| 3v2d_5 | 60 | 50S ribosomal protein L32; ribosome associated inh | 80.01 |
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
Probab=100.00 E-value=9.4e-39 Score=294.36 Aligned_cols=194 Identities=19% Similarity=0.267 Sum_probs=170.8
Q ss_pred cccceeccccccCCCCCCcchHHHHHHHHhhhhcCCCCcCCCCCCcccccCCCCcceeecCCCCceeecCCcEEEEEEEe
Q 022283 70 RASRVCATRSESNQDATSSHPSSAAVHSAGNVLKISFCQWCGGQTKHEVPHGEEKMRAICTVCGKIAYQNPKMVVGCLIE 149 (299)
Q Consensus 70 ~~~~~~~~r~~~~~~~~~~~~~~~a~~l~~w~~~~~fC~~CG~~~~~~~~~~~~~~~~~C~~Cg~~~y~~p~~vV~~iv~ 149 (299)
.++++.++|+++..+..++.++++|.+|.+|+++++|||.||+++... ++++++.|++||..+||++.++|++++.
T Consensus 73 ~~~~~~~lr~~~~~~~~~~~~~~~a~~l~~w~~~~~fC~~CG~~~~~~----~~~~~~~C~~C~~~~yp~~~~~viv~v~ 148 (269)
T 1vk6_A 73 RRHDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPS----KTEWAMLCSHCRERYYPQIAPCIIVAIR 148 (269)
T ss_dssp CSSCEECTTHHHHHCHHHHHHHHHHHHHHHHHHTTSBCTTTCCBEEEC----SSSSCEEESSSSCEECCCCEEEEEEEEE
T ss_pred CCccchhHHHHhcCCHHHhHHHHHHHHHHhhhhcCCccccCCCcCccC----CCceeeeCCCCCCEecCCCCcEEEEEEE
Confidence 466788899765447677889999999999999999999999999775 6889999999999999999999999999
Q ss_pred eCCEEEEEEeecCCCCCceeeceEEeeCCCCHHHHHHHHHHHHhCCceeeccceeeeecCCCCEEEEEEEEEecCCCCCC
Q 022283 150 HDKKILLCKRKIEPSYGLWTLPAGYMEIGESAAEGAIRETWEEARADVEVQSPFAQLDIPRIGQIYIIFLAKLKRPHFSP 229 (299)
Q Consensus 150 ~~~kILL~rr~~~p~~g~w~lPgG~VE~GEs~eeAa~REv~EEtGl~v~~~~~~~~~~~p~~~~~~~~f~a~~~~~~~~~ 229 (299)
++++|||+||+..+ .|.|++|||+||+|||+++||+||++||||+++..+.+++++++++++.++++|.+++.++++.+
T Consensus 149 ~~~~vLL~rr~~~~-~g~w~lPgG~vE~GEt~eeAa~REv~EEtGl~v~~~~~~~~~~~~~~~~~~~~f~a~~~~~~~~~ 227 (269)
T 1vk6_A 149 RDDSILLAQHTRHR-NGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGDIVI 227 (269)
T ss_dssp ETTEEEEEEETTTC-SSCCBCEEEECCTTCCHHHHHHHHHHHHHCCEEEEEEEEEEEEEETTEEEEEEEEEEEEECCCCC
T ss_pred eCCEEEEEEecCCC-CCcEECCcCcCCCCCCHHHHHHHHHHHHhCceeeeEEEEEEEecCCCCEEEEEEEEEECCCCcCC
Confidence 99999999998776 79999999999999999999999999999999999999999999999999999999988777666
Q ss_pred C-CcceeeEEecCCCCCCCCCCCccHHHHHHHHHHHHHcC
Q 022283 230 G-PESSECRLFALDEIPFDSLAFSSISVTLQLFIDDIRMG 268 (299)
Q Consensus 230 ~-~E~~~~~W~~~deL~~~~laf~s~~~~l~~~l~~~~~g 268 (299)
+ +|..+++||++++++......+..+.+++.|++..+++
T Consensus 228 ~~~E~~~~~W~~~~el~~l~~~~si~~~li~~~l~~~r~~ 267 (269)
T 1vk6_A 228 DPKELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRAE 267 (269)
T ss_dssp CTTTEEEEEEEETTSCCSCCCTTSHHHHHHHHHHHHHHHC
T ss_pred CCcceEEEEEEEHHHhhhcccCcHHHHHHHHHHHHHHHhh
Confidence 5 78999999999999954443344577888888776644
|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* | Back alignment and structure |
|---|
| >3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A | Back alignment and structure |
|---|
| >3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* | Back alignment and structure |
|---|
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* | Back alignment and structure |
|---|
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* | Back alignment and structure |
|---|
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A | Back alignment and structure |
|---|
| >3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 | Back alignment and structure |
|---|
| >3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... | Back alignment and structure |
|---|
| >1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A | Back alignment and structure |
|---|
| >1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... | Back alignment and structure |
|---|
| >2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 | Back alignment and structure |
|---|
| >2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 | Back alignment and structure |
|---|
| >3v2d_5 50S ribosomal protein L32; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 2hgq_4 2hgj_4 2hgu_4 2j03_5 2jl6_5 2jl8_5 2v47_5 2v49_5 2wdi_5 2wdj_5 2wdl_5 2wdn_5 2wh2_5 2wh4_5 2wrj_5 2wrl_5 2wro_5 2wrr_5 2x9s_5 2x9u_5 ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 299 | ||||
| d2fmla2 | 202 | d.113.1.6 (A:3-204) Hypothetical protein EF2700, N | 9e-23 | |
| d2b0va1 | 146 | d.113.1.1 (A:4-149) Hypothetical protein NE0184 {N | 1e-21 | |
| d1irya_ | 156 | d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha | 2e-20 | |
| d1vk6a2 | 131 | d.113.1.4 (A:126-256) NADH pyrophosphatase {Escher | 2e-19 | |
| d2fb1a2 | 147 | d.113.1.6 (A:3-149) Hypothetical protein BT0354, N | 8e-17 | |
| d1vcda1 | 126 | d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t | 6e-16 | |
| d1sjya_ | 158 | d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc | 8e-16 | |
| d2b06a1 | 155 | d.113.1.1 (A:1-155) Hypothetical protein SP1235 (s | 1e-15 | |
| d2azwa1 | 147 | d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E | 2e-15 | |
| d1ryaa_ | 160 | d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD | 3e-15 | |
| d2fvva1 | 135 | d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat | 4e-15 | |
| d1xsba_ | 153 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 7e-14 | |
| d1k2ea_ | 152 | d.113.1.1 (A:) Hypothetical protein PAE3301 {Archa | 1e-13 | |
| d2a6ta2 | 151 | d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c | 8e-13 | |
| d1u20a1 | 196 | d.113.1.1 (A:14-209) U8 snorna-binding protein x29 | 3e-12 | |
| d1puna_ | 129 | d.113.1.1 (A:) Nucleoside triphosphate pyrophospho | 5e-11 | |
| d1rrqa2 | 127 | d.113.1.3 (A:234-360) Adenine glycosylase MutY, C- | 8e-10 | |
| d1q33a_ | 292 | d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyr | 2e-09 | |
| d1v8ya_ | 158 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus | 2e-08 | |
| d1jkna_ | 165 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 6e-07 | |
| d1vhza_ | 186 | d.113.1.1 (A:) ADP compounds hydrolase NudE {Esche | 2e-06 | |
| d1nqza_ | 187 | d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinoco | 1e-05 | |
| d1mqea_ | 202 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobac | 1e-05 | |
| d1hzta_ | 153 | d.113.1.2 (A:) Isopentenyl diphosphate isomerase { | 2e-05 | |
| d1x51a1 | 142 | d.113.1.3 (A:8-149) A/G-specific adenine DNA glyco | 1e-04 | |
| d1g0sa_ | 209 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escheri | 0.001 |
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Length = 202 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: BT0354 N-terminal domain-like domain: Hypothetical protein EF2700, N-terminal domain species: Enterococcus faecalis [TaxId: 1351]
Score = 91.4 bits (226), Expect = 9e-23
Identities = 31/176 (17%), Positives = 56/176 (31%), Gaps = 12/176 (6%)
Query: 106 FCQWCGGQTKHEVPHGEEKMRAICTVCGKIAYQNPKMVVGCLI------EHDKKILLCKR 159
F + +E + Y+ P + V ++ K+LL +R
Sbjct: 2 FASKAEEKNYYERQASLAEFLTWYHQQELPEYEKPSLTVDMVLLCYNKEADQLKVLLIQR 61
Query: 160 KIEPSYGLWTLPAGYMEIGESAAEGAIRETWEEARADVEVQSPFAQLDIPRIGQ------ 213
K P W LP G++ ES + +RET EE + ++ R +
Sbjct: 62 KGHPFRNSWALPGGFVNRNESTEDSVLRETKEETGVVISQENIEQLHSFSRPDRDPRGWV 121
Query: 214 IYIIFLAKLKRPHFSPGPESSECRLFALDEIPFDSLAFSSISVTLQLFIDDIRMGK 269
+ + +LA + G ++ E F L+ +GK
Sbjct: 122 VTVSYLAFIGEEPLIAGDDAKEVHWFNLERHGQHITLSHEDVEITLDLKTAASLGK 177
|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Length = 146 | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 131 | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 147 | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Length = 155 | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 152 | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 196 | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Length = 129 | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 127 | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 158 | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Length = 165 | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Length = 186 | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Length = 187 | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 202 | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Length = 153 | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 209 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 299 | |||
| d1vk6a2 | 131 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 99.92 | |
| d2b0va1 | 146 | Hypothetical protein NE0184 {Nitrosomonas europaea | 99.87 | |
| d2fb1a2 | 147 | Hypothetical protein BT0354, N-terminal domain {Ba | 99.86 | |
| d1irya_ | 156 | 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum | 99.83 | |
| d2fmla2 | 202 | Hypothetical protein EF2700, N-terminal domain {En | 99.83 | |
| d1sjya_ | 158 | Hypothetical protein DR1025 {Deinococcus radiodura | 99.82 | |
| d1vcda1 | 126 | AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: | 99.82 | |
| d1puna_ | 129 | Nucleoside triphosphate pyrophosphorylase (MutT) { | 99.82 | |
| d1ryaa_ | 160 | GDP-mannose mannosyl hydrolase NudD {Escherichia c | 99.77 | |
| d1k2ea_ | 152 | Hypothetical protein PAE3301 {Archaeon Pyrobaculum | 99.77 | |
| d2azwa1 | 147 | Hypothetical protein EF1141 {Enterococcus faecalis | 99.76 | |
| d2b06a1 | 155 | Hypothetical protein SP1235 (spr1115) {Streptococc | 99.76 | |
| d2a6ta2 | 151 | mRNA decapping enzyme Dcp2p catalytic domain {Schi | 99.75 | |
| d1ktga_ | 137 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.75 | |
| d1jkna_ | 165 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.74 | |
| d2fkba1 | 161 | Hypothetical protein YfcD {Escherichia coli [TaxId | 99.73 | |
| d1v8ya_ | 158 | ADP-ribose pyrophosphatase {Thermus thermophilus [ | 99.72 | |
| d2fvva1 | 135 | Diphosphoinositol polyphosphate phosphohydrolase { | 99.69 | |
| d1xsba_ | 153 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.68 | |
| d1vhza_ | 186 | ADP compounds hydrolase NudE {Escherichia coli [Ta | 99.68 | |
| d2o5fa1 | 162 | Hypothetical protein DR0079 {Deinococcus radiodura | 99.67 | |
| d1rrqa2 | 127 | Adenine glycosylase MutY, C-terminal domain {Bacil | 99.66 | |
| d1hzta_ | 153 | Isopentenyl diphosphate isomerase {Escherichia col | 99.66 | |
| d1mqea_ | 202 | ADP-ribose pyrophosphatase {Mycobacterium tubercul | 99.6 | |
| d1nqza_ | 187 | Coenzyme A pyrophosphatase {Deinococcus radioduran | 99.58 | |
| d1g0sa_ | 209 | ADP-ribose pyrophosphatase {Escherichia coli [TaxI | 99.53 | |
| d1q33a_ | 292 | NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { | 99.47 | |
| d1u20a1 | 196 | U8 snorna-binding protein x29 {African clawed frog | 99.46 | |
| d1viua_ | 189 | ADP-ribose pyrophosphatase homologue YffH {Escheri | 99.38 | |
| d1x51a1 | 142 | A/G-specific adenine DNA glycosylase {Human (Homo | 99.29 | |
| d1vk6a4 | 29 | NADH pyrophosphatase intervening domain {Escherich | 97.48 | |
| d1vk6a3 | 97 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 96.24 | |
| d2k4xa1 | 55 | Ribosomal protein S27ae {Thermoplasma acidophilum | 95.4 | |
| d2akla2 | 38 | Hypothetical protein PA0128, N-terminal domain {Ps | 93.98 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 90.88 | |
| d2jnya1 | 59 | Uncharacterized protein Cgl1405/cg1592 {Corynebact | 89.31 | |
| d1twfi1 | 49 | RBP9 subunit of RNA polymerase II {Baker's yeast ( | 86.14 | |
| d2j0151 | 59 | Ribosomal protein L32p {Thermus thermophilus [TaxI | 85.35 | |
| d2hf1a1 | 59 | Hypothetical protein CV3345 {Chromobacterium viola | 85.12 | |
| d2pk7a1 | 59 | Uncharacterized protein PFL1779 {Pseudomonas fluor | 82.76 | |
| d2zjrz1 | 58 | Ribosomal protein L32p {Deinococcus radiodurans [T | 82.72 |
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: NADH pyrophosphatase domain: NADH pyrophosphatase species: Escherichia coli [TaxId: 562]
Probab=99.92 E-value=1e-24 Score=177.52 Aligned_cols=126 Identities=20% Similarity=0.244 Sum_probs=107.1
Q ss_pred CcEEEEEEEeeCCEEEEEEeecCCCCCceeeceEEeeCCCCHHHHHHHHHHHHhCCceeeccceeeeecCCCCEEEEEEE
Q 022283 140 PKMVVGCLIEHDKKILLCKRKIEPSYGLWTLPAGYMEIGESAAEGAIRETWEEARADVEVQSPFAQLDIPRIGQIYIIFL 219 (299)
Q Consensus 140 p~~vV~~iv~~~~kILL~rr~~~p~~g~w~lPgG~VE~GEs~eeAa~REv~EEtGl~v~~~~~~~~~~~p~~~~~~~~f~ 219 (299)
..|+|++++.+++++||+||++.+ .|.|++|||+||+|||+++||+||++||||+++....+++....+..+..+++|.
T Consensus 2 i~paViv~i~~~~~vLL~~~~~~~-~g~w~lpGG~ve~GEt~~~aa~REl~EEtG~~~~~~~~~~~~~~~~~~~~~~~f~ 80 (131)
T d1vk6a2 2 IAPCIIVAIRRDDSILLAQHTRHR-NGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPFPQSLMTAFM 80 (131)
T ss_dssp CEEEEEEEEEETTEEEEEEETTTC-SSCCBCEEEECCTTCCHHHHHHHHHHHHHCCEEEEEEEEEEEEEETTEEEEEEEE
T ss_pred cccEEEEEEEeCCEEEEEEeccCC-CCCEecccCCCcCCCcHHHHHHHHHHHHhCCcccceeEEEEeccCcCceEEEEEE
Confidence 357888888999999999988765 6899999999999999999999999999999999999998888888888889999
Q ss_pred EEecCCCCCCC-CcceeeEEecCCCCCCCCCCCccHHHHHHHHHHHHH
Q 022283 220 AKLKRPHFSPG-PESSECRLFALDEIPFDSLAFSSISVTLQLFIDDIR 266 (299)
Q Consensus 220 a~~~~~~~~~~-~E~~~~~W~~~deL~~~~laf~s~~~~l~~~l~~~~ 266 (299)
+....+++..+ .|+.+++||+++||+......+-.+.+|+++++..+
T Consensus 81 ~~~~~~~~~~~~~E~~~~~W~~~~el~~l~~~~~i~r~li~~~l~~~r 128 (131)
T d1vk6a2 81 AEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCR 128 (131)
T ss_dssp EEEEECCCCCCTTTEEEEEEEETTSCCSCCCTTSHHHHHHHHHHHHHH
T ss_pred EEEcCCcccCCCccEEEEEEEcHHHHhhCCCChHHHHHHHHHHHHHHH
Confidence 99888877776 889999999999999443333334667788877654
|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vk6a4 g.41.14.1 (A:97-125) NADH pyrophosphatase intervening domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vk6a3 d.113.1.4 (A:0-96) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1twfi1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2zjrz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|