Citrus Sinensis ID: 022313

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MTSETASKDCLGWAARDPSGVLSPYSFNRRAVGSDDVSITITHCGVCYADVIWTRNKHGDSKYPLVPGHEIVGIVKEVGHNVSRFKVGDHVGVGTYVNSCRDCEYCNDGLEVHCARSVYTFNAIDADGTITKGGYSSYIVVHERYCYKIANDYPLALAAPLLCAGITVYTPMMRHKMNQPGKSLGVIGLGGLGHMAVKFGKAFGLNVTVLSTSTSKKEEALSLLGADKFVVSSDLEQMKALGKSLDFIIDTASGDHPFDAYMSLLKVAGVYVLVGFPSKVKFSPASLNIGNAPLFRFKS
cccccccccEEEEEEEccccccccEEEEccccccccEEEEEEEEEccccHHHHHcccccccccccccccEEEEEEEEEcccccccccccEEEEEEECcccccccHcccccccccccccccccccccccccccccccccEEEcccEEEEccccccccccccccccccccccccccccccccccEEEEECcccHHHHHHHHHHHcccEEEEEEccccHHHHHHHHccccCEECcccHHHHHHHHccccEEEEcccccccHHHHHHccccccEEEEEcccccccccccccccccccEEECcc
******S**CLGWAARDPSGVLSPYSFNRRAVGSDDVSITITHCGVCYADVIWTRNKHGDSKYPLVPGHEIVGIVKEVGHNVSRFKVGDHVGVGTYVNSCRDCEYCNDGLEVHCARSVYTFNAIDADGTITKGGYSSYIVVHERYCYKIANDYPLALAAPLLCAGITVYTPMMRHKMNQPGKSLGVIGLGGLGHMAVKFGKAFGLNVTVLSTSTSK***ALSLLGADKFVVSSDLEQMKALGKSLDFIIDTASGDHPFDAYMSLLKVAGVYVLVGFPSKVKFSPASLNIGNAPLFR***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSETASKDCLGWAARDPSGVLSPYSFNRRAVGSDDVSITITHCGVCYADVIWTRNKHGDSKYPLVPGHEIVGIVKEVGHNVSRFKVGDHVGVGTYVNSCRDCEYCNDGLEVHCARSVYTFNAIDADGTITKGGYSSYIVVHERYCYKIANDYPLALAAPLLCAGITVYTPMMRHKMNQPGKSLGVIGLGGLGHMAVKFGKAFGLNVTVLSTSTSKKEEALSLLGADKFVVSSDLEQMKALGKSLDFIIDTASGDHPFDAYMSLLKVAGVYVLVGFPSKVKFSPASLNIGNAPLFRFKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable cinnamyl alcohol dehydrogenase 1 Involved in lignin biosynthesis. Catalyzes the final step specific for the production of lignin monomers, like coniferyl alcohol, sinapyl alcohol and 4-coumaryl alcohol.confidentQ8H859
Probable cinnamyl alcohol dehydrogenase 1 Involved in lignin biosynthesis. Catalyzes the final step specific for the production of lignin monomers, like coniferyl alcohol, sinapyl alcohol and 4-coumaryl alcohol.confidentQ9CAI3
Putative cinnamyl alcohol dehydrogenase 4 Involved in lignin biosynthesis. Catalyzes the final step specific for the production of lignin monomers, like coniferyl alcohol, sinapyl alcohol and 4-coumaryl alcohol.probableQ2R114

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CF5, chain A
Confidence level:very confident
Coverage over the Query: 6-298
View the alignment between query and template
View the model in PyMOL