Citrus Sinensis ID: 022330

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30

MSSSFTGSFGDDDFMAYDPRLASQGFNSSFSQFEGDSVKDSAGDSSPIFSSQSYGAGDEVFSSNPLPDTPSPPSIYAAGGGFSSFSPERNGKSFGGGFGAEDDSILPPPTEMPAEEGFALREWRRQNAIRLEQKEKKEREMLREIIEEAEQYKVEFYRKRALAVENNKASNREKEKLFLASWEKFHGEAEKNYWKAIAELIPYEVPAIEKRGKKKDQEKKKPSIIVIQGPKPGKPTDLSRMRQILVKLKHNPPPHMNPKPPPPPQTEPTKDAKTSPAVGSGTATSKPAAPATPKGVAAA

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccHHHHHccccccHcccccccEEcccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccc

******G****DDFM*****************************SSP*************************************************************************REWRR*N*****************IIEEAEQYKVEFYRKRALAV***********KLFLASWEKFHGEAEKNYWKAIAELIPYEVPAI*****************************LSRMRQILVKLKH*************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSSFTGSFGDDDFMAYDPRLASQGFNSSFSQFEGDSVKDSAGDSSPIFSSQSYGAGDEVFSSNPLPDTPSPPSIYAAGGGFSSFSPERNGKSFGGGFGAEDDSILPPPTEMPAEEGFAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFYRKRALAVENNKASNREKEKLFLASWEKFHGEAEKNYWKAIAELIPYEVPAIEKRGKKKDQEKKKPSIIVIQGPKPGKPTDLSRMRQILVKLKHNPPPHMNPKPPPPPQTEPTKDAKTSPAVGSGTATSKPAAPATPKGVAAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Clathrin light chain 3	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.	probable	F4J5M9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LVH, chain D
Confidence level:very confident
Coverage over the Query: 109-185
View the alignment between query and template
View the model in PyMOL