Citrus Sinensis ID: 022337

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MLLTFSPQFIVCGCINLLSVSQIEVIQKMPSTCSLFRDEVREHLLTVPGEAEAEDDNQIQKPKFRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEGTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSEAKHPMALRFLQLSG
ccccccccEEEEEcccccEEHHHHHHHccccccccccHHHHHccccccccccccccccccccEEEEEccEEECcccccccccccEEEccccEEEEEccccccHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHccEECcccccccccHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccEEEEccccccccHHccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHcEEEEEEccEEEEEcccccccccccHHHHHHccccc
**LTFSPQFIVCGCINLLSVSQIEVIQKMPSTCSLFRDEVREHLLT*****************FRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEGTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSEAKHPMALRFLQL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLTFSPQFIVCGCINLLSVSQIEVIQKMPSTCSLFRDEVREHLLTVPGEAEAEDDNQIQKPKFRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEGTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSEAKHPMALRFLQLSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ABC transporter I family member 17 probableQ9C9W0
Protein STAR1 Associates with STAR2 to form a functional transmembrane ABC transporter required for detoxification of aluminum (Al) in roots. Can specifically transport UDP-glucose.probableQ0D9V6
Putative ABC transporter ATP-binding protein YjkB probableO34756

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 60-126,138-276
View the alignment between query and template
View the model in PyMOL
Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 62-286
View the alignment between query and template
View the model in PyMOL