Citrus Sinensis ID: 022337


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MLLTFSPQFIVCGCINLLSVSQIEVIQKMPSTCSLFRDEVREHLLTVPGEAEAEDDNQIQKPKFRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEGTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSEAKHPMALRFLQLSG
ccccccccEEEEEcccccEEHHHHHHHccccccccccHHHHHccccccccccccccccccccEEEEEccEEEEcccccccccccEEEccccEEEEEccccccHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHccEEEcccccccccHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccEEEEccccccccHHccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHcEEEEEEccEEEEEcccccccccccHHHHHHccccc
cHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEEEEEEccccccEEEEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEEEccEEcccccHHHHHHHccccccccEEEHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEEcHHHHHHHccHHHHHHHHHcc
mlltfspqfIVCGCINLLSVSQIEVIQkmpstcslFRDEVREHLltvpgeaeaeddnqiqkpKFRVRELrkesddgapilkgvnmeipkgvimgiigpsgsgKSTLLRALNrlweppsgtvfldgrditdldVLSLRRKVGMlfqipalfegtvvdnirygpqlrgkklteNEVYKLLSLADldssflnktggeiSVGQAQRVALARTLanepevllldeptsaldpistQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIvevlkpdllseakhpmALRFLQLSG
MLLTFSPQFIVCGCINLLSVSQIEVIQKMPSTCSLFRDEVREHLLTvpgeaeaeddnqiqkpkfrvrelrkesddgapilkgvnmeipKGVIMGIIGPSGSGKSTLLRALNRLWEppsgtvfldgrditDLDVLSLRRKVGMLFqipalfegtvvdnirygpqlrgkkltENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVLLldeptsaldpistQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLkpdllseakhpmalrflqlsg
MLLTFSPQFIVCGCINLLSVSQIEVIQKMPSTCSLFRDEVREHLLTVPGEAEAEDDNQIQKPKFRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEGTVVDNIRYGPQLRGKKLTENEVYKllsladldssflNKTGGEISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSEAKHPMALRFLQLSG
**LTFSPQFIVCGCINLLSVSQIEVIQKMPSTCSLFRDEVREHLLT********************************ILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEGTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSEA*************
***TFSPQFIVCGCINLLS********************************************FRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEGTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTG**ISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSEAKHPMALRFLQL**
MLLTFSPQFIVCGCINLLSVSQIEVIQKMPSTCSLFRDEVREHLLTVPGEAEAEDDNQIQKPKFRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEGTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSEAKHPMALRFLQLSG
MLLTFSPQFIVCGCINLLSVSQIEVIQKMPSTCSLFRDEVREHLLTVPGEAEAEDDNQIQKPKFRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEGTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSEAKHPMALRFLQLS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLTFSPQFIVCGCINLLSVSQIEVIQKMPSTCSLFRDEVREHLLTVPGEAEAEDDNQIQKPKFRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEGTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSEAKHPMALRFLQLSG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query298 2.2.26 [Sep-21-2011]
Q9C9W0263 ABC transporter I family yes no 0.875 0.992 0.7 1e-105
Q0D9V6346 Protein STAR1 OS=Oryza sa yes no 0.882 0.760 0.686 1e-97
Q8RCU0239 Phosphate import ATP-bind yes no 0.674 0.841 0.475 3e-48
Q8R9I2249 Phosphate import ATP-bind no no 0.651 0.779 0.471 1e-43
O27764253 Phosphate import ATP-bind yes no 0.667 0.786 0.448 5e-42
Q12XW6255 Phosphate import ATP-bind yes no 0.661 0.772 0.454 6e-42
Q9X0Y8251 Phosphate import ATP-bind yes no 0.651 0.772 0.459 2e-41
O28912251 Phosphate import ATP-bind yes no 0.661 0.784 0.443 2e-40
Q2NHW1252 Phosphate import ATP-bind yes no 0.708 0.837 0.410 1e-39
Q3AAA4253 Phosphate import ATP-bind yes no 0.674 0.794 0.425 4e-39
>sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 Back     alignment and function desciption
 Score =  381 bits (978), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/270 (70%), Positives = 225/270 (83%), Gaps = 9/270 (3%)

Query: 29  MPSTCSLFRD-EVREHLLTVPGEAEAEDDNQIQKPKFRVRELRKESDDGAPILKGVNMEI 87
           MPS  S   D  +REHL+ V             +PK RV +L + +DDG+ ILKGV ++I
Sbjct: 1   MPSLWSNESDGSLREHLVDVVVSG--------SEPKIRVHDLTRVADDGSRILKGVTIDI 52

Query: 88  PKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIP 147
           PKG+I+G+IGPSGSGKST LR+LNRLWEPP  TVFLDG DIT++DV++LRR+VGMLFQ+P
Sbjct: 53  PKGMIVGVIGPSGSGKSTFLRSLNRLWEPPESTVFLDGEDITNVDVIALRRRVGMLFQLP 112

Query: 148 ALFEGTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALAR 207
            LF+GTV DN+RYGP LRG+KL++ EVYKLLSLADLD+SF  KTG E+SVGQAQRVALAR
Sbjct: 113 VLFQGTVADNVRYGPNLRGEKLSDEEVYKLLSLADLDASFAKKTGAELSVGQAQRVALAR 172

Query: 208 TLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCL 267
           TLANEPEVLLLDEPTSALDPIST+NIEDV+VKLKK+ G+T V+VSHSIKQIQ++AD+VCL
Sbjct: 173 TLANEPEVLLLDEPTSALDPISTENIEDVIVKLKKQRGITTVIVSHSIKQIQKVADIVCL 232

Query: 268 LVNGEIVEVLKPDLLSEAKHPMALRFLQLS 297
           +V+GEIVEVLKP  LS A HPMA RFLQLS
Sbjct: 233 VVDGEIVEVLKPSELSHATHPMAQRFLQLS 262





Arabidopsis thaliana (taxid: 3702)
>sp|Q0D9V6|STAR1_ORYSJ Protein STAR1 OS=Oryza sativa subsp. japonica GN=STAR1 PE=1 SV=1 Back     alignment and function description
>sp|Q8RCU0|PSTB1_THETN Phosphate import ATP-binding protein PstB 1 OS=Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB1 PE=3 SV=1 Back     alignment and function description
>sp|Q8R9I2|PSTB2_THETN Phosphate import ATP-binding protein PstB 2 OS=Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB2 PE=3 SV=1 Back     alignment and function description
>sp|O27764|PSTB_METTH Phosphate import ATP-binding protein PstB OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pstB PE=3 SV=1 Back     alignment and function description
>sp|Q12XW6|PSTB_METBU Phosphate import ATP-binding protein PstB OS=Methanococcoides burtonii (strain DSM 6242) GN=pstB PE=3 SV=1 Back     alignment and function description
>sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 Back     alignment and function description
>sp|O28912|PSTB_ARCFU Phosphate import ATP-binding protein PstB OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pstB PE=3 SV=1 Back     alignment and function description
>sp|Q2NHW1|PSTB_METST Phosphate import ATP-binding protein PstB OS=Methanosphaera stadtmanae (strain DSM 3091) GN=pstB PE=3 SV=1 Back     alignment and function description
>sp|Q3AAA4|PSTB_CARHZ Phosphate import ATP-binding protein PstB OS=Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008) GN=pstB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
255562070276 phosphate abc transporter, putative [Ric 0.892 0.963 0.779 1e-113
224144230272 predicted protein [Populus trichocarpa] 0.845 0.926 0.808 1e-111
225445992268 PREDICTED: ABC transporter I family memb 0.828 0.921 0.802 1e-111
147791112251 hypothetical protein VITISV_010974 [Viti 0.822 0.976 0.813 1e-110
297841533262 ATNAP3 [Arabidopsis lyrata subsp. lyrata 0.875 0.996 0.710 1e-104
15220604263 ABC transporter I family member 17 [Arab 0.875 0.992 0.7 1e-103
356524710260 PREDICTED: ABC transporter I family memb 0.848 0.973 0.730 1e-103
4586576261 multidrug resistance protein [Cicer arie 0.865 0.988 0.722 1e-103
449466057269 PREDICTED: ABC transporter I family memb 0.845 0.936 0.734 1e-102
357521679255 ABC transporter I family member [Medicag 0.835 0.976 0.723 1e-100
>gi|255562070|ref|XP_002522043.1| phosphate abc transporter, putative [Ricinus communis] gi|223538642|gb|EEF40243.1| phosphate abc transporter, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/267 (77%), Positives = 230/267 (86%), Gaps = 1/267 (0%)

Query: 31  STCSLFRDEVREHLLTVPGEAEAEDDNQIQKPKFRVRELRKESDDGAPILKGVNMEIPKG 90
           S  S   D   EHLLTV  + E+  DN   + KFR+R L +E+D GA IL GVN+++PKG
Sbjct: 10  SRVSAANDGTLEHLLTVT-DIESATDNDDNQYKFRIRNLTRETDGGAKILNGVNLDVPKG 68

Query: 91  VIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIPALF 150
           VI+GI+GPSGSGKST LR+LNRLWEPP GTVFLDG DI DLDVLSLRRKVGMLFQIP LF
Sbjct: 69  VIVGIVGPSGSGKSTFLRSLNRLWEPPPGTVFLDGCDIRDLDVLSLRRKVGMLFQIPVLF 128

Query: 151 EGTVVDNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLA 210
           EGT+ DNIRYGPQLRGKKL++NEV+KLL LADLDSSF  K  GE+SVGQAQRVALARTLA
Sbjct: 129 EGTIADNIRYGPQLRGKKLSDNEVHKLLILADLDSSFHKKNYGELSVGQAQRVALARTLA 188

Query: 211 NEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVN 270
           NEPEVLLLDEPTSALDPISTQNIE+V+VKLKK  GMTIVMVSHSIKQIQR+ADVVCLLVN
Sbjct: 189 NEPEVLLLDEPTSALDPISTQNIEEVIVKLKKNQGMTIVMVSHSIKQIQRVADVVCLLVN 248

Query: 271 GEIVEVLKPDLLSEAKHPMALRFLQLS 297
           GE+VEVLKP+ LSEAKHPMA RFLQLS
Sbjct: 249 GEVVEVLKPNELSEAKHPMAQRFLQLS 275




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224144230|ref|XP_002325227.1| predicted protein [Populus trichocarpa] gi|222866661|gb|EEF03792.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225445992|ref|XP_002266816.1| PREDICTED: ABC transporter I family member 17 [Vitis vinifera] gi|297735429|emb|CBI17869.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147791112|emb|CAN70271.1| hypothetical protein VITISV_010974 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297841533|ref|XP_002888648.1| ATNAP3 [Arabidopsis lyrata subsp. lyrata] gi|297334489|gb|EFH64907.1| ATNAP3 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15220604|ref|NP_176961.1| ABC transporter I family member 17 [Arabidopsis thaliana] gi|75333593|sp|Q9C9W0.1|AB17I_ARATH RecName: Full=ABC transporter I family member 17; Short=ABC transporter ABCI.17; Short=AtABCI17; AltName: Full=MRP-related protein 1; AltName: Full=Non-intrinsic ABC protein 3 gi|12324076|gb|AAG52004.1|AC012563_14 putative ABC transporter; 66585-65723 [Arabidopsis thaliana] gi|21554406|gb|AAM63511.1| putative ABC transporter [Arabidopsis thaliana] gi|26450485|dbj|BAC42356.1| putative ABC transporter [Arabidopsis thaliana] gi|28827588|gb|AAO50638.1| putative ABC transporter protein [Arabidopsis thaliana] gi|298286464|dbj|BAJ09459.1| sensitive to aluminum rhizotoxicity 1 [Arabidopsis thaliana] gi|332196603|gb|AEE34724.1| ABC transporter I family member 17 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356524710|ref|XP_003530971.1| PREDICTED: ABC transporter I family member 17-like [Glycine max] Back     alignment and taxonomy information
>gi|4586576|dbj|BAA76420.1| multidrug resistance protein [Cicer arietinum] Back     alignment and taxonomy information
>gi|449466057|ref|XP_004150743.1| PREDICTED: ABC transporter I family member 17-like [Cucumis sativus] gi|449506635|ref|XP_004162805.1| PREDICTED: ABC transporter I family member 17-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357521679|ref|XP_003631128.1| ABC transporter I family member [Medicago truncatula] gi|217072754|gb|ACJ84737.1| unknown [Medicago truncatula] gi|355525150|gb|AET05604.1| ABC transporter I family member [Medicago truncatula] gi|388494374|gb|AFK35253.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
TAIR|locus:2200226263 ABCI17 "ATP-binding cassette I 0.875 0.992 0.662 1.4e-89
UNIPROTKB|Q0D9V6346 STAR1 "Protein STAR1" [Oryza s 0.865 0.745 0.669 5.4e-86
TIGR_CMR|CHY_2116253 CHY_2116 "phosphate ABC transp 0.728 0.857 0.403 3.9e-37
TIGR_CMR|DET_0141251 DET_0141 "phosphate ABC transp 0.654 0.776 0.414 1.5e-35
TIGR_CMR|CPS_3640279 CPS_3640 "phosphate ABC transp 0.651 0.695 0.411 7.4e-34
UNIPROTKB|P30750343 metN [Escherichia coli K-12 (t 0.718 0.623 0.370 9.5e-34
UNIPROTKB|Q9KN92251 pstB2 "Phosphate import ATP-bi 0.651 0.772 0.408 9.5e-34
TIGR_CMR|VC_A0073251 VC_A0073 "phosphate ABC transp 0.651 0.772 0.408 9.5e-34
UNIPROTKB|Q9KU04273 pstB1 "Phosphate import ATP-bi 0.667 0.728 0.406 1.2e-33
TIGR_CMR|VC_0726273 VC_0726 "phosphate ABC transpo 0.667 0.728 0.406 1.2e-33
TAIR|locus:2200226 ABCI17 "ATP-binding cassette I17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 894 (319.8 bits), Expect = 1.4e-89, P = 1.4e-89
 Identities = 179/270 (66%), Positives = 214/270 (79%)

Query:    29 MPSTCSLFRD-EVREHLLTVPGEAEAEDDNQIQKPKFRVRELRKESDDGAPILKGVNMEI 87
             MPS  S   D  +REHL+ V             +PK RV +L + +DDG+ ILKGV ++I
Sbjct:     1 MPSLWSNESDGSLREHLVDVVVSGS--------EPKIRVHDLTRVADDGSRILKGVTIDI 52

Query:    88 PKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVGMLFQIP 147
             PKG+I+G+IGPSGSGKST LR+LNRLWEPP  TVFLDG DIT++DV++LRR+VGMLFQ+P
Sbjct:    53 PKGMIVGVIGPSGSGKSTFLRSLNRLWEPPESTVFLDGEDITNVDVIALRRRVGMLFQLP 112

Query:   148 ALFEGTVVDNIRYGPQLRGKKLTENEVYKXXXXXXXXXXXXNKTGGEISVGQAQRVALAR 207
              LF+GTV DN+RYGP LRG+KL++ EVYK             KTG E+SVGQAQRVALAR
Sbjct:   113 VLFQGTVADNVRYGPNLRGEKLSDEEVYKLLSLADLDASFAKKTGAELSVGQAQRVALAR 172

Query:   208 TLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCL 267
             TLANEPEVLLLDEPTSALDPIST+NIEDV+VKLKK+ G+T V+VSHSIKQIQ++AD+VCL
Sbjct:   173 TLANEPEVLLLDEPTSALDPISTENIEDVIVKLKKQRGITTVIVSHSIKQIQKVADIVCL 232

Query:   268 LVNGEIVEVLKPDLLSEAKHPMALRFLQLS 297
             +V+GEIVEVLKP  LS A HPMA RFLQLS
Sbjct:   233 VVDGEIVEVLKPSELSHATHPMAQRFLQLS 262




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005215 "transporter activity" evidence=ISS
GO:0005315 "inorganic phosphate transmembrane transporter activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0016020 "membrane" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0035435 "phosphate ion transmembrane transport" evidence=IEA
GO:0005774 "vacuolar membrane" evidence=IDA
UNIPROTKB|Q0D9V6 STAR1 "Protein STAR1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2116 CHY_2116 "phosphate ABC transporter, ATP-binding protein PstB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0141 DET_0141 "phosphate ABC transporter, ATP-binding protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3640 CPS_3640 "phosphate ABC transporter, ATP-binding protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P30750 metN [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KN92 pstB2 "Phosphate import ATP-binding protein PstB 2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_A0073 VC_A0073 "phosphate ABC transporter, ATP-binding protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KU04 pstB1 "Phosphate import ATP-binding protein PstB 1" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0726 VC_0726 "phosphate ABC transporter, ATP-binding protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C9W0AB17I_ARATHNo assigned EC number0.70.87580.9923yesno
O34756YJKB_BACSUNo assigned EC number0.38050.81200.968yesno
Q0D9V6STAR1_ORYSJNo assigned EC number0.68670.88250.7601yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.30.766
3rd Layer3.6.3.27LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.XVIII.243.1
hypothetical protein (246 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.164370001
Bacterial phosphate transport system-like permease; Part of a binding-protein-dependent transpo [...] (277 aa)
      0.743
eugene3.00040892
hypothetical protein (556 aa)
       0.485
gw1.70.18.1
hypothetical protein (186 aa)
       0.482
gw1.VI.1378.1
hypothetical protein (166 aa)
       0.480
eugene3.00010837
hypothetical protein (344 aa)
       0.479
gw1.XIV.855.1
hypothetical protein (292 aa)
       0.477
grail3.0018035601
hypothetical protein (378 aa)
       0.477
grail3.0005026601
hypothetical protein (446 aa)
       0.477
grail3.0015025801
hypothetical protein (443 aa)
       0.474
gw1.16438.2.1
Predicted protein (167 aa)
       0.473

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 9e-99
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 2e-77
COG1117253 COG1117, PstB, ABC-type phosphate transport system 2e-73
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 4e-70
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 5e-68
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 9e-64
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 6e-63
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 1e-62
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 9e-61
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 9e-61
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 1e-60
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 3e-60
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 1e-59
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 2e-59
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 8e-59
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 1e-57
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 1e-57
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 2e-56
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 3e-56
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 3e-55
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 3e-55
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 5e-55
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 6e-55
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 7e-55
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 7e-55
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 1e-54
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 3e-54
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 2e-53
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 4e-53
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transpo 5e-53
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 6e-53
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 1e-52
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 1e-52
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 1e-52
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 3e-52
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 3e-52
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 4e-52
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 6e-52
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine tr 3e-51
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 2e-50
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 2e-50
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 7e-50
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 1e-49
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 1e-49
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transpor 2e-49
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 3e-49
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine tran 3e-49
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 3e-49
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 4e-49
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 5e-49
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 8e-49
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 1e-48
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 2e-48
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 3e-48
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 3e-48
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 4e-48
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 5e-48
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 1e-47
COG4988559 COG4988, CydD, ABC-type transport system involved 2e-47
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 2e-47
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 3e-47
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 3e-47
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 3e-47
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 4e-47
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 5e-47
COG1123 539 COG1123, COG1123, ATPase components of various ABC 1e-46
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 1e-46
COG1123539 COG1123, COG1123, ATPase components of various ABC 2e-46
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 2e-46
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 2e-46
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 3e-46
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 3e-46
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 4e-46
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 4e-46
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 4e-46
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 9e-46
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 2e-45
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 2e-45
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 2e-45
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 7e-45
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 1e-44
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 1e-44
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 1e-44
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 1e-44
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 2e-44
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 2e-44
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 2e-44
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 3e-44
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 1e-43
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 1e-43
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 1e-43
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 1e-43
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 5e-43
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 6e-43
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 7e-43
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 7e-43
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 2e-41
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 3e-41
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 3e-41
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 7e-41
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 1e-40
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 1e-40
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 4e-40
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 6e-40
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 6e-40
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 7e-40
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 9e-40
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 1e-39
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 2e-39
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 3e-39
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 4e-39
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter AT 6e-39
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 8e-39
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 2e-38
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 7e-38
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 7e-38
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 9e-38
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 1e-37
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 1e-37
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 2e-37
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-37
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 4e-37
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 5e-37
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 5e-37
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 6e-37
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 7e-37
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 7e-37
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 8e-37
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 8e-37
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 9e-37
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 1e-36
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 1e-36
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 1e-36
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 2e-36
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 3e-36
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 3e-36
COG5265497 COG5265, ATM1, ABC-type transport system involved 3e-36
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 4e-36
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 4e-36
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 5e-36
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding 6e-36
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 7e-36
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 1e-35
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 1e-35
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 1e-35
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 1e-35
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 2e-35
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 2e-35
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 2e-35
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transpor 3e-35
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 3e-35
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 4e-35
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 5e-35
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 6e-35
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transpo 7e-35
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 8e-35
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 9e-35
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 1e-34
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 2e-34
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 2e-34
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 4e-34
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 5e-34
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 6e-34
COG4525259 COG4525, TauB, ABC-type taurine transport system, 7e-34
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 7e-34
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 1e-33
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 1e-33
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 2e-33
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 4e-33
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 4e-33
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 5e-33
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 5e-33
COG4987573 COG4987, CydC, ABC-type transport system involved 5e-33
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 9e-33
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 9e-33
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 1e-32
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporte 2e-32
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 4e-32
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 4e-32
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 4e-32
TIGR03415 382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 9e-32
PRK11000 369 PRK11000, PRK11000, maltose/maltodextrin transport 1e-31
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 1e-31
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 1e-31
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 2e-31
PRK11432 351 PRK11432, fbpC, ferric transporter ATP-binding sub 3e-31
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 7e-31
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 7e-31
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 8e-31
COG4598256 COG4598, HisP, ABC-type histidine transport system 1e-30
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 1e-30
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 1e-30
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 2e-30
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 2e-30
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 2e-30
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 3e-30
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 3e-30
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 8e-30
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 1e-29
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 1e-29
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 2e-29
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 2e-29
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 3e-29
COG4148 352 COG4148, ModC, ABC-type molybdate transport system 4e-29
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 4e-29
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 9e-29
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 1e-28
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 1e-28
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 2e-28
pfam00005119 pfam00005, ABC_tran, ABC transporter 2e-28
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; 3e-28
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 4e-28
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 4e-28
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 4e-28
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 7e-28
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 9e-28
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 3e-27
cd03234226 cd03234, ABCG_White, White pigment protein homolog 3e-27
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 5e-27
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 6e-27
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 6e-27
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 1e-26
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 2e-26
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 2e-26
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 3e-26
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 5e-26
COG0488530 COG0488, Uup, ATPase components of ABC transporter 8e-26
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 9e-26
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 1e-25
PRK11650 356 PRK11650, ugpC, glycerol-3-phosphate transporter A 3e-25
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 3e-25
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 5e-25
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 1e-24
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-24
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 4e-24
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-bind 6e-24
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 7e-24
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 8e-24
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 1e-23
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 2e-23
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 2e-23
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 3e-23
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 5e-23
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 9e-23
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 1e-22
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 1e-22
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 2e-22
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-22
PRK11144 352 PRK11144, modC, molybdate transporter ATP-binding 2e-22
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 2e-22
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 4e-22
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 4e-22
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 4e-22
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 5e-22
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 5e-22
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 7e-22
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter A 9e-22
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 1e-21
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 1e-21
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 2e-21
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 3e-21
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 4e-21
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 6e-21
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 9e-21
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 9e-21
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 5e-20
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 6e-20
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter 6e-20
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 7e-20
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 9e-20
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 1e-19
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide tran 2e-19
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 2e-19
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 2e-19
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 3e-19
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 4e-19
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 4e-19
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 1e-18
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 1e-18
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 3e-18
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 3e-18
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC tran 6e-18
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 6e-18
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 8e-18
COG4133209 COG4133, CcmA, ABC-type transport system involved 9e-18
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-17
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 2e-17
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 2e-17
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding 6e-17
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 4e-16
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 4e-16
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 4e-16
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP 5e-16
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding 5e-16
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 5e-16
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 6e-16
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 6e-16
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 1e-15
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 1e-15
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 2e-15
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 2e-15
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 2e-15
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 3e-15
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 5e-15
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 6e-15
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 7e-15
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 8e-15
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 8e-15
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 1e-14
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 1e-14
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside t 1e-14
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 2e-14
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 2e-14
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Tra 2e-14
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-bi 3e-14
PRK11819 556 PRK11819, PRK11819, putative ABC transporter ATP-b 3e-14
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 6e-14
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 8e-14
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 9e-14
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 1e-13
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 1e-13
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 2e-13
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 2e-13
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 3e-13
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 4e-13
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP bindi 6e-13
PRK13545 549 PRK13545, tagH, teichoic acids export protein ATP- 1e-12
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 1e-12
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 2e-12
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-bindi 2e-12
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 4e-12
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 5e-12
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 5e-12
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 1e-11
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 1e-11
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provision 1e-11
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 1e-11
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase compone 9e-11
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 1e-10
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 1e-10
cd03270226 cd03270, ABC_UvrA_I, ATP-binding cassette domain I 1e-10
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 2e-10
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 2e-10
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 3e-10
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 4e-10
smart00382148 smart00382, AAA, ATPases associated with a variety 4e-10
PRK15064 530 PRK15064, PRK15064, ABC transporter ATP-binding pr 5e-10
cd03271261 cd03271, ABC_UvrA_II, ATP-binding cassette domain 5e-10
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 8e-10
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 1e-09
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 1e-09
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 6e-09
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 9e-09
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 1e-08
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-08
cd03222177 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassett 2e-08
PRK10938 490 PRK10938, PRK10938, putative molybdenum transport 3e-08
PLN03073 718 PLN03073, PLN03073, ABC transporter F family; Prov 2e-07
PRK13546264 PRK13546, PRK13546, teichoic acids export protein 2e-07
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 3e-07
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protei 1e-06
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 2e-06
cd03240204 cd03240, ABC_Rad50, ATP-binding cassette domain of 2e-06
COG0178935 COG0178, UvrA, Excinuclease ATPase subunit [DNA re 2e-05
PRK10636 638 PRK10636, PRK10636, putative ABC transporter ATP-b 7e-05
TIGR00630925 TIGR00630, uvra, excinuclease ABC, A subunit 7e-05
PRK10938490 PRK10938, PRK10938, putative molybdenum transport 1e-04
PRK00349943 PRK00349, uvrA, excinuclease ABC subunit A; Review 1e-04
PRK00635 1809 PRK00635, PRK00635, excinuclease ABC subunit A; Pr 1e-04
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 2e-04
pfam02456370 pfam02456, Adeno_IVa2, Adenovirus IVa2 protein 3e-04
pfam13304256 pfam13304, AAA_21, AAA domain 3e-04
COG0178 935 COG0178, UvrA, Excinuclease ATPase subunit [DNA re 5e-04
pfam1355560 pfam13555, AAA_29, P-loop containing region of AAA 7e-04
COG0178935 COG0178, UvrA, Excinuclease ATPase subunit [DNA re 0.001
TIGR00630925 TIGR00630, uvra, excinuclease ABC, A subunit 0.001
PRK05541176 PRK05541, PRK05541, adenylylsulfate kinase; Provis 0.001
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 0.001
pfam13604195 pfam13604, AAA_30, AAA domain 0.001
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 0.001
COG0178 935 COG0178, UvrA, Excinuclease ATPase subunit [DNA re 0.002
pfam13304256 pfam13304, AAA_21, AAA domain 0.002
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase compone 0.004
TIGR00630 925 TIGR00630, uvra, excinuclease ABC, A subunit 0.004
TIGR00630 925 TIGR00630, uvra, excinuclease ABC, A subunit 0.004
PRK00349 943 PRK00349, uvrA, excinuclease ABC subunit A; Review 0.004
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 0.004
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
 Score =  289 bits (741), Expect = 9e-99
 Identities = 112/230 (48%), Positives = 147/230 (63%), Gaps = 14/230 (6%)

Query: 64  FRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWE-----PPS 118
             +R+L     D    LK ++++IPKG I  +IGPSG GKSTLLR LNRL +     P  
Sbjct: 1   IELRDLNVYYGDKH-ALKDISLDIPKGEITALIGPSGCGKSTLLRLLNRLNDLIPGAPDE 59

Query: 119 GTVFLDGRDITDLD--VLSLRRKVGMLFQIPALFEGTVVDNIRYGPQLRGKKLTEN---E 173
           G V LDG+DI DLD  VL LRR+VGM+FQ P  F G++ DN+ YG +L G KL E     
Sbjct: 60  GEVLLDGKDIYDLDVDVLELRRRVGMVFQKPNPFPGSIYDNVAYGLRLHGIKLKEELDER 119

Query: 174 VYKLLSLADLDSSFLNKTGG-EISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQN 232
           V + L  A L     ++     +S GQ QR+ LAR LANEPEVLLLDEPTSALDPIST  
Sbjct: 120 VEEALRKAALWDEVKDRLHALGLSGGQQQRLCLARALANEPEVLLLDEPTSALDPISTAK 179

Query: 233 IEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLL 282
           IE+++ +LKK+   TIV+V+H+++Q  R+AD    L+NG +VE    + +
Sbjct: 180 IEELIAELKKE--YTIVIVTHNMQQAARVADRTAFLLNGRLVEFGPTEQI 227


Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. PstA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD). Length = 227

>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|185049 PRK15093, PRK15093, antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233206 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184130 PRK13545, tagH, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|213237 cd03270, ABC_UvrA_I, ATP-binding cassette domain I of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213238 cd03271, ABC_UvrA_II, ATP-binding cassette domain II of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|213189 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassette domain of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|184131 PRK13546, PRK13546, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184128 PRK13541, PRK13541, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 Back     alignment and domain information
>gnl|CDD|223256 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit Back     alignment and domain information
>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>gnl|CDD|234734 PRK00349, uvrA, excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|234806 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|145542 pfam02456, Adeno_IVa2, Adenovirus IVa2 protein Back     alignment and domain information
>gnl|CDD|222036 pfam13304, AAA_21, AAA domain Back     alignment and domain information
>gnl|CDD|223256 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|205733 pfam13555, AAA_29, P-loop containing region of AAA domain Back     alignment and domain information
>gnl|CDD|223256 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit Back     alignment and domain information
>gnl|CDD|235498 PRK05541, PRK05541, adenylylsulfate kinase; Provisional Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|222258 pfam13604, AAA_30, AAA domain Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|223256 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|222036 pfam13304, AAA_21, AAA domain Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit Back     alignment and domain information
>gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit Back     alignment and domain information
>gnl|CDD|234734 PRK00349, uvrA, excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 298
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 100.0
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 100.0
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 100.0
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 100.0
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 100.0
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1123 539 ATPase components of various ABC-type transport sy 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10261 623 glutathione transporter ATP-binding protein; Provi 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 100.0
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
PRK10938 490 putative molybdenum transport ATP-binding protein 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK09580248 sufC cysteine desulfurase ATPase component; Review 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 100.0
PTZ002431560 ABC transporter; Provisional 100.0
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 100.0
COG4619223 ABC-type uncharacterized transport system, ATPase 100.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 100.0
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
COG4161242 ArtP ABC-type arginine transport system, ATPase co 100.0
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 100.0
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
COG3845 501 ABC-type uncharacterized transport systems, ATPase 100.0
COG4148 352 ModC ABC-type molybdate transport system, ATPase c 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
cd03216163 ABC_Carb_Monos_I This family represents the domain 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 100.0
PRK13546264 teichoic acids export protein ATP-binding subunit; 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 100.0
COG4172 534 ABC-type uncharacterized transport system, duplica 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
PRK15064 530 ABC transporter ATP-binding protein; Provisional 100.0
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
PRK10535 648 macrolide transporter ATP-binding /permease protei 100.0
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 100.0
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 100.0
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
PLN03211 659 ABC transporter G-25; Provisional 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
COG4674249 Uncharacterized ABC-type transport system, ATPase 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
COG4167267 SapF ABC-type antimicrobial peptide transport syst 100.0
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 100.0
COG1119257 ModF ABC-type molybdenum transport system, ATPase 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 100.0
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 100.0
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 100.0
COG1101263 PhnK ABC-type uncharacterized transport system, AT 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 100.0
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
COG4586325 ABC-type uncharacterized transport system, ATPase 100.0
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 100.0
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 100.0
PRK11147 635 ABC transporter ATPase component; Reviewed 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
PRK13409 590 putative ATPase RIL; Provisional 100.0
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 100.0
COG4136213 ABC-type uncharacterized transport system, ATPase 100.0
PLN03073 718 ABC transporter F family; Provisional 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
PTZ00243 1560 ABC transporter; Provisional 100.0
KOG0054 1381 consensus Multidrug resistance-associated protein/ 100.0
COG0488 530 Uup ATPase components of ABC transporters with dup 100.0
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 100.0
KOG0059885 consensus Lipid exporter ABCA1 and related protein 100.0
COG4133209 CcmA ABC-type transport system involved in cytochr 100.0
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 100.0
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 100.0
COG0488530 Uup ATPase components of ABC transporters with dup 100.0
PF00005137 ABC_tran: ABC transporter This structure is on hol 100.0
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 100.0
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 100.0
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 100.0
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 100.0
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 100.0
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 100.0
COG4170330 SapD ABC-type antimicrobial peptide transport syst 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 100.0
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.98
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.98
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.98
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 99.97
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.97
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.97
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.97
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.96
KOG0927 614 consensus Predicted transporter (ABC superfamily) 99.96
KOG0062582 consensus ATPase component of ABC transporters wit 99.96
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.96
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.96
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.96
KOG0062 582 consensus ATPase component of ABC transporters wit 99.96
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.95
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.95
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 99.93
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.93
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.93
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.93
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.91
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.91
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.9
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 99.9
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.9
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.89
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.89
PRK006351809 excinuclease ABC subunit A; Provisional 99.89
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 99.88
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.87
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.86
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 99.85
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.85
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 99.84
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 99.84
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 99.82
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 99.8
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 99.79
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 99.73
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 99.72
PRK00064361 recF recombination protein F; Reviewed 99.71
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 99.71
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 99.71
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 99.67
KOG0063 592 consensus RNAse L inhibitor, ABC superfamily [RNA 99.65
PRK07721438 fliI flagellum-specific ATP synthase; Validated 99.64
cd01128249 rho_factor Transcription termination factor rho is 99.63
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.62
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 99.59
PRK00409 782 recombination and DNA strand exchange inhibitor pr 99.59
TIGR00634563 recN DNA repair protein RecN. All proteins in this 99.57
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 99.57
PHA02562562 46 endonuclease subunit; Provisional 99.54
PRK08533230 flagellar accessory protein FlaH; Reviewed 99.53
PRK10869553 recombination and repair protein; Provisional 99.52
PRK13695174 putative NTPase; Provisional 99.51
PRK03918880 chromosome segregation protein; Provisional 99.47
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 99.47
TIGR006061311 rad50 rad50. This family is based on the phylogeno 99.47
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 99.47
PRK01156895 chromosome segregation protein; Provisional 99.45
cd01124187 KaiC KaiC is a circadian clock protein primarily f 99.45
PRK102461047 exonuclease subunit SbcC; Provisional 99.44
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 99.42
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 99.42
PRK13830818 conjugal transfer protein TrbE; Provisional 99.39
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 99.39
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 99.37
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 99.36
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 99.35
COG3910233 Predicted ATPase [General function prediction only 99.33
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 99.28
PRK06067234 flagellar accessory protein FlaH; Validated 99.25
PRK02224880 chromosome segregation protein; Provisional 99.24
smart00382148 AAA ATPases associated with a variety of cellular 99.18
PRK06002450 fliI flagellum-specific ATP synthase; Validated 99.16
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 99.14
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 99.14
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 99.09
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 99.08
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 99.07
TIGR00611365 recf recF protein. All proteins in this family for 99.01
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 99.0
PRK07196434 fliI flagellum-specific ATP synthase; Validated 98.99
PRK13891852 conjugal transfer protein TrbE; Provisional 98.98
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 98.97
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 98.96
PRK14079349 recF recombination protein F; Provisional 98.89
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 98.88
TIGR026801353 conserved hypothetical protein TIGR02680. Members 98.86
PRK06315442 type III secretion system ATPase; Provisional 98.86
PRK09825176 idnK D-gluconate kinase; Provisional 98.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.8
PRK05399854 DNA mismatch repair protein MutS; Provisional 98.79
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.78
PRK08149428 ATP synthase SpaL; Validated 98.78
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.74
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 98.72
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 98.71
PRK13898800 type IV secretion system ATPase VirB4; Provisional 98.71
PRK01889356 GTPase RsgA; Reviewed 98.7
PRK00300205 gmk guanylate kinase; Provisional 98.69
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.68
TIGR00235207 udk uridine kinase. Model contains a number of lon 98.67
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 98.67
TIGR00152188 dephospho-CoA kinase. This model produces scores i 98.67
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 98.65
PRK07594433 type III secretion system ATPase SsaN; Validated 98.65
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 98.63
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 98.61
PRK10416318 signal recognition particle-docking protein FtsY; 98.59
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.59
PRK09862506 putative ATP-dependent protease; Provisional 98.58
TIGR00767415 rho transcription termination factor Rho. Members 98.58
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 98.58
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.55
TIGR02546422 III_secr_ATP type III secretion apparatus H+-trans 98.53
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 98.52
PTZ00035337 Rad51 protein; Provisional 98.51
PRK09270229 nucleoside triphosphate hydrolase domain-containin 98.51
PRK13873811 conjugal transfer ATPase TrbE; Provisional 98.5
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=8.4e-69  Score=464.37  Aligned_cols=233  Identities=40%  Similarity=0.621  Sum_probs=209.7

Q ss_pred             CeEEEEeEEEEeCCCCcceeeeeEEEeCCcEEEEEcCCCccHHHHHHHHhcCCCCCccEEEECCEeCCCC-CHHHHhcce
Q 022337           62 PKFRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDL-DVLSLRRKV  140 (298)
Q Consensus        62 ~~l~~~~l~~~y~~~~~vL~~isl~i~~Ge~~~iiG~nGsGKSTLlk~l~gl~~p~~G~I~i~g~~i~~~-~~~~~~~~i  140 (298)
                      ++|+++||+|+|+ +..||+|||++|++||+++|+||||||||||||||+||..|++|+|+++|+++... +...+|+++
T Consensus         1 ~mi~i~~l~K~fg-~~~VLkgi~l~v~~Gevv~iiGpSGSGKSTlLRclN~LE~~~~G~I~i~g~~~~~~~~~~~~R~~v   79 (240)
T COG1126           1 MMIEIKNLSKSFG-DKEVLKGISLSVEKGEVVVIIGPSGSGKSTLLRCLNGLEEPDSGSITVDGEDVGDKKDILKLRRKV   79 (240)
T ss_pred             CeEEEEeeeEEeC-CeEEecCcceeEcCCCEEEEECCCCCCHHHHHHHHHCCcCCCCceEEECCEeccchhhHHHHHHhc
Confidence            4799999999994 67899999999999999999999999999999999999999999999999877432 456789999


Q ss_pred             EEEeCCCCCCcc-cHHHHhHhCcc-ccCCC--ccHHHHHHHHHHcCCCchhhcCCCCCCChhHHHHHHHHHHHcCCCCeE
Q 022337          141 GMLFQIPALFEG-TVVDNIRYGPQ-LRGKK--LTENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVL  216 (298)
Q Consensus       141 g~v~Q~~~l~~~-tv~eni~~~~~-~~~~~--~~~~~~~~~l~~~~l~~~~~~~~~~~LSgGqkQRv~iAral~~~p~il  216 (298)
                      |+|||+++|||. ||.||+.+++. ..+.+  +.++++.++|+++||. +..+.||.+|||||||||||||||+.+|+++
T Consensus        80 GmVFQ~fnLFPHlTvleNv~lap~~v~~~~k~eA~~~A~~lL~~VGL~-~ka~~yP~qLSGGQqQRVAIARALaM~P~vm  158 (240)
T COG1126          80 GMVFQQFNLFPHLTVLENVTLAPVKVKKLSKAEAREKALELLEKVGLA-DKADAYPAQLSGGQQQRVAIARALAMDPKVM  158 (240)
T ss_pred             CeecccccccccchHHHHHHhhhHHHcCCCHHHHHHHHHHHHHHcCch-hhhhhCccccCcHHHHHHHHHHHHcCCCCEE
Confidence            999999999996 99999999863 23332  3356688999999997 5799999999999999999999999999999


Q ss_pred             EEeCcCCCCCHHHHHHHHHHHHHHHhcCCcEEEEEccCHHHHHhhcCEEEEEeCCEEEEeeChhhhhc-cCChHHHHHhh
Q 022337          217 LLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSE-AKHPMALRFLQ  295 (298)
Q Consensus       217 lLDEPts~LD~~~~~~~~~~l~~l~~~~g~tii~itHd~~~~~~~~d~v~vl~~G~i~~~g~~~~~~~-~~~~~~~~~~~  295 (298)
                      |+|||||+|||+...++++.+++++++ |.|.|+|||+|.++.+.||||++|++|+|++.|+|+++.. +.++-.+.|+.
T Consensus       159 LFDEPTSALDPElv~EVL~vm~~LA~e-GmTMivVTHEM~FAr~VadrviFmd~G~iie~g~p~~~f~~p~~~R~~~FL~  237 (240)
T COG1126         159 LFDEPTSALDPELVGEVLDVMKDLAEE-GMTMIIVTHEMGFAREVADRVIFMDQGKIIEEGPPEEFFDNPKSERTRQFLS  237 (240)
T ss_pred             eecCCcccCCHHHHHHHHHHHHHHHHc-CCeEEEEechhHHHHHhhheEEEeeCCEEEEecCHHHHhcCCCCHHHHHHHH
Confidence            999999999999999999999999876 9999999999999999999999999999999999999864 45666777766


Q ss_pred             hc
Q 022337          296 LS  297 (298)
Q Consensus       296 ~~  297 (298)
                      ..
T Consensus       238 ~i  239 (240)
T COG1126         238 KI  239 (240)
T ss_pred             hh
Confidence            43



>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK13891 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK05399 DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK13898 type IV secretion system ATPase VirB4; Provisional Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK13873 conjugal transfer ATPase TrbE; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 7e-34
3tui_C366 Inward Facing Conformations Of The Metni Methionine 1e-33
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 1e-32
3g60_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-31
3g5u_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-31
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 4e-30
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 6e-30
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 8e-30
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 9e-30
2it1_A 362 Structure Of Ph0203 Protein From Pyrococcus Horikos 1e-29
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 2e-29
1z47_A 355 Structure Of The Atpase Subunit Cysa Of The Putativ 5e-29
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 2e-26
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 3e-26
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 3e-26
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 3e-26
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 4e-26
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 5e-26
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 7e-26
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 8e-26
1oxs_C 353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 9e-26
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 2e-25
1oxx_K 353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 4e-25
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 6e-25
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 6e-25
3d31_A 348 Modbc From Methanosarcina Acetivorans Length = 348 1e-24
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 2e-24
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 4e-24
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 4e-24
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 5e-24
2yyz_A 359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 5e-24
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 6e-24
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 7e-24
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 1e-23
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 3e-23
1q1b_A 381 Crystal Structure Of E. Coli Malk In The Nucleotide 6e-23
1q12_A 381 Crystal Structure Of The Atp-bound E. Coli Malk Len 6e-23
2r6g_A 381 The Crystal Structure Of The E. Coli Maltose Transp 1e-22
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 5e-21
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 4e-20
1vci_A 373 Crystal Structure Of The Atp-binding Cassette Of Mu 4e-20
1v43_A 372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 4e-20
1g29_1 372 Malk Length = 372 8e-20
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 1e-19
2d62_A 375 Crystal Structure Of Multiple Sugar Binding Transpo 2e-19
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 3e-19
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 8e-19
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 1e-18
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-18
1b0u_A262 Atp-Binding Subunit Of The Histidine Permease From 4e-18
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 6e-18
3fvq_A 359 Crystal Structure Of The Nucleotide Binding Domain 7e-18
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 6e-17
4g1u_C266 X-Ray Structure Of The Bacterial Heme Transporter H 8e-17
1g6h_A257 Crystal Structure Of The Adp Conformation Of Mj1267 2e-16
1g9x_A257 Characterization Of The Twinning Structure Of Mj126 5e-16
1gaj_A257 Crystal Structure Of A Nucleotide-Free Atp-Binding 1e-15
1ji0_A240 Crystal Structure Analysis Of The Abc Transporter F 1e-14
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 4e-14
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 4e-14
4fwi_B334 Crystal Structure Of The Nucleotide-binding Domain 3e-13
1sgw_A214 Putative Abc Transporter (Atp-Binding Protein) From 5e-13
1yqt_A538 Rnase-L Inhibitor Length = 538 1e-12
3j15_B593 Model Of Ribosome-Bound Archaeal Pelota And Abce1 L 2e-12
3bk7_A607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 2e-12
2nq2_C253 An Inward-Facing Conformation Of A Putative Metal-C 2e-12
3gd7_A 390 Crystal Structure Of Human Nbd2 Complexed With N6- 8e-12
2ihy_A279 Structure Of The Staphylococcus Aureus Putative Atp 1e-10
1q3h_A286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 1e-10
1r0z_A286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 1e-10
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 1e-10
2pzf_A228 Minimal Human Cftr First Nucleotide Binding Domain 2e-10
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 2e-10
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 2e-10
3si7_A285 The Crystal Structure Of The Nbd1 Domain Of The Mou 2e-10
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 2e-10
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 3e-10
1xfa_A283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 3e-10
1xmj_A290 Crystal Structure Of Human Deltaf508 Human Nbd1 Dom 3e-10
1xf9_A283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 3e-10
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 3e-10
2bbo_A291 Human Nbd1 With Phe508 Length = 291 4e-10
2pjz_A263 The Crystal Structure Of Putative Cobalt Transport 6e-10
2d2e_A250 Crystal Structure Of Atypical Cytoplasmic Abc-Atpas 7e-10
4dbl_C249 Crystal Structure Of E159q Mutant Of Btucdf Length 3e-09
4fi3_C249 Structure Of Vitamin B12 Transporter Btucd-F In A N 4e-09
2qi9_C249 Abc-Transporter Btucd In Complex With Its Periplasm 2e-07
2zu0_C267 Crystal Structure Of Sufc-Sufd Complex Involved In 2e-07
2d3w_A248 Crystal Structure Of Escherichia Coli Sufc, An Atpa 2e-07
1l7v_C249 Bacterial Abc Transporter Involved In B12 Uptake Le 3e-07
3ozx_A538 Crystal Structure Of Abce1 Of Sulfolubus Solfataric 9e-06
3j16_B 608 Models Of Ribosome-Bound Dom34p And Rli1p And Their 6e-05
3ux8_A670 Crystal Structure Of Uvra Length = 670 7e-05
3uwx_A972 Crystal Structure Of Uvra-Uvrb Complex Length = 972 8e-05
2r6f_A972 Crystal Structure Of Bacillus Stearothermophilus Uv 8e-05
2iwh_A 986 Structure Of Yeast Elongation Factor 3 In Complex W 2e-04
2ix8_A 976 Model For Eef3 Bound To An 80s Ribosome Length = 97 3e-04
2iw3_A 986 Elongation Factor 3 In Complex With Adp Length = 98 4e-04
2vf7_A842 Crystal Structure Of Uvra2 From Deinococcus Radiodu 7e-04
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure

Iteration: 1

Score = 140 bits (354), Expect = 7e-34, Method: Compositional matrix adjust. Identities = 83/224 (37%), Positives = 135/224 (60%), Gaps = 10/224 (4%) Query: 80 LKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDL---DVLSL 136 L V++ +P G I G+IG SG+GKSTL+R +N L P G+V +DG+++T L ++ Sbjct: 21 LNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKA 80 Query: 137 RRKVGMLFQIPALFEG-TVVDNIRYGPQLRGKKLTENEVYKXXXXXXXXXXXXNKTGG-- 193 RR++GM+FQ L TV N+ +L ++EV + +K Sbjct: 81 RRQIGMIFQHFNLLSSRTVFGNVALPLELDNTP--KDEVKRRVTELLSLVGLGDKHDSYP 138 Query: 194 -EISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVS 252 +S GQ QRVA+AR LA+ P+VLL DE TSALDP +T++I ++L + ++ G+TI++++ Sbjct: 139 SNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLIT 198 Query: 253 HSIKQIQRIADVVCLLVNGEIVEV-LKPDLLSEAKHPMALRFLQ 295 H + ++RI D V ++ NGE++E ++ S K P+A +F+Q Sbjct: 199 HEMDVVKRICDCVAVISNGELIEQDTVSEVFSHPKTPLAQKFIQ 242
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 Back     alignment and structure
>pdb|1SGW|A Chain A, Putative Abc Transporter (Atp-Binding Protein) From Pyrococcus Furiosus Pfu-867808-001 Length = 214 Back     alignment and structure
>pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 Back     alignment and structure
>pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 Back     alignment and structure
>pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|2PJZ|A Chain A, The Crystal Structure Of Putative Cobalt Transport Atp- Binding Protein (cbio-2), St1066 Length = 263 Back     alignment and structure
>pdb|2D2E|A Chain A, Crystal Structure Of Atypical Cytoplasmic Abc-Atpase Sufc From Thermus Thermophilus Hb8 Length = 250 Back     alignment and structure
>pdb|4DBL|C Chain C, Crystal Structure Of E159q Mutant Of Btucdf Length = 249 Back     alignment and structure
>pdb|4FI3|C Chain C, Structure Of Vitamin B12 Transporter Btucd-F In A Nucleotide-Bound State Length = 249 Back     alignment and structure
>pdb|2QI9|C Chain C, Abc-Transporter Btucd In Complex With Its Periplasmic Binding Protein Btuf Length = 249 Back     alignment and structure
>pdb|2ZU0|C Chain C, Crystal Structure Of Sufc-Sufd Complex Involved In The Iron- Sulfur Cluster Biosynthesis Length = 267 Back     alignment and structure
>pdb|2D3W|A Chain A, Crystal Structure Of Escherichia Coli Sufc, An Atpase Compenent Of The Suf Iron-Sulfur Cluster Assembly Machinery Length = 248 Back     alignment and structure
>pdb|1L7V|C Chain C, Bacterial Abc Transporter Involved In B12 Uptake Length = 249 Back     alignment and structure
>pdb|3OZX|A Chain A, Crystal Structure Of Abce1 Of Sulfolubus Solfataricus (-Fes Domain) Length = 538 Back     alignment and structure
>pdb|3J16|B Chain B, Models Of Ribosome-Bound Dom34p And Rli1p And Their Ribosomal Binding Partners Length = 608 Back     alignment and structure
>pdb|3UX8|A Chain A, Crystal Structure Of Uvra Length = 670 Back     alignment and structure
>pdb|3UWX|A Chain A, Crystal Structure Of Uvra-Uvrb Complex Length = 972 Back     alignment and structure
>pdb|2R6F|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Uvra Length = 972 Back     alignment and structure
>pdb|2IWH|A Chain A, Structure Of Yeast Elongation Factor 3 In Complex With Adpnp Length = 986 Back     alignment and structure
>pdb|2IX8|A Chain A, Model For Eef3 Bound To An 80s Ribosome Length = 976 Back     alignment and structure
>pdb|2IW3|A Chain A, Elongation Factor 3 In Complex With Adp Length = 986 Back     alignment and structure
>pdb|2VF7|A Chain A, Crystal Structure Of Uvra2 From Deinococcus Radiodurans Length = 842 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 2e-63
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 1e-60
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 7e-60
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 4e-57
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 2e-54
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 1e-53
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 3e-53
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 2e-53
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 6e-52
1sgw_A214 Putative ABC transporter; structural genomics, P p 2e-51
1b0u_A262 Histidine permease; ABC transporter, transport pro 1e-50
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 1e-50
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 2e-49
2ghi_A260 Transport protein; multidrug resistance protein, M 8e-49
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 1e-47
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 3e-47
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 4e-46
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 9e-46
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 2e-45
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 6e-45
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 9e-45
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-44
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 2e-44
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-44
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 5e-44
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 2e-43
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 1e-42
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 5e-41
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 6e-35
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 3e-40
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 5e-40
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 6e-40
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 2e-32
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 2e-37
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 2e-37
1g6h_A257 High-affinity branched-chain amino acid transport 6e-37
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 8e-36
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 9e-36
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 6e-34
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 6e-35
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 1e-33
1ji0_A240 ABC transporter; ATP binding protein, structural g 1e-31
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 5e-30
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 7e-29
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 6e-28
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 4e-27
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 3e-26
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 4e-26
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 4e-26
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 8e-26
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-19
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-10
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 8e-07
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 4e-17
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 4e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-12
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 3e-08
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 4e-07
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 4e-05
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 8e-05
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 1e-04
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 1e-04
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 2e-04
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 2e-04
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 2e-04
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 6e-04
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
 Score =  203 bits (518), Expect = 2e-63
 Identities = 88/225 (39%), Positives = 138/225 (61%), Gaps = 12/225 (5%)

Query: 80  LKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSL--- 136
           L  V++ +P G I G+IG SG+GKSTL+R +N L  P  G+V +DG+++T L    L   
Sbjct: 44  LNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKA 103

Query: 137 RRKVGMLFQIPALFEG-TVVDNIRYGPQLRG--KKLTENEVYKLLSLADLDSSFLNKTGG 193
           RR++GM+FQ   L    TV  N+    +L    K   +  V +LLSL  L     +    
Sbjct: 104 RRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGL-GDKHDSYPS 162

Query: 194 EISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSH 253
            +S GQ QRVA+AR LA+ P+VLL D+ TSALDP +T++I ++L  + ++ G+TI++++H
Sbjct: 163 NLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTILLITH 222

Query: 254 SIKQIQRIADVVCLLVNGEIVE---VLKPDLLSEAKHPMALRFLQ 295
            +  ++RI D V ++ NGE++E   V   ++ S  K P+A +F+Q
Sbjct: 223 EMDVVKRICDCVAVISNGELIEQDTVS--EVFSHPKTPLAQKFIQ 265


>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Length = 842 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Length = 365 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Length = 670 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Length = 916 Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Length = 972 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 100.0
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 100.0
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 100.0
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 100.0
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 100.0
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 100.0
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 100.0
1b0u_A262 Histidine permease; ABC transporter, transport pro 100.0
1ji0_A240 ABC transporter; ATP binding protein, structural g 100.0
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 100.0
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 100.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 100.0
1g6h_A257 High-affinity branched-chain amino acid transport 100.0
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 100.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 100.0
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 100.0
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 100.0
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 100.0
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 100.0
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 100.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 100.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 100.0
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 100.0
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 100.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 100.0
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 100.0
2ghi_A260 Transport protein; multidrug resistance protein, M 100.0
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 100.0
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 100.0
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 100.0
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 100.0
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 100.0
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 100.0
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 100.0
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 100.0
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 100.0
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 100.0
1sgw_A214 Putative ABC transporter; structural genomics, P p 100.0
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 100.0
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 100.0
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 100.0
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 100.0
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 100.0
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 100.0
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 100.0
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 100.0
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 100.0
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 100.0
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 100.0
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 100.0
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 100.0
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 100.0
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 100.0
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 100.0
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 100.0
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 100.0
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 100.0
4aby_A415 DNA repair protein RECN; hydrolase, double strand 100.0
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.98
1e69_A322 Chromosome segregation SMC protein; structural mai 99.97
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.97
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.97
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.97
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 99.96
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.96
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.96
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.96
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.95
2og2_A359 Putative signal recognition particle receptor; nuc 99.95
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.95
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.94
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.94
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.94
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.94
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.94
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.93
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 99.93
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.93
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.92
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.92
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.92
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.92
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.91
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.91
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.9
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 99.89
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.89
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.89
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.89
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.89
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.89
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.88
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.88
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.88
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 99.88
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.88
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 99.88
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.87
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.87
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 99.87
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 99.87
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.86
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.85
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 99.84
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.83
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 99.81
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.81
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.8
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.78
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 99.78
3kta_B173 Chromosome segregation protein SMC; structural mai 99.77
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 99.76
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 99.76
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 99.76
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 99.76
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.75
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 99.75
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.75
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 99.75
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 99.75
2ewv_A372 Twitching motility protein PILT; pilus retraction 99.74
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 99.72
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.71
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.7
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.68
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 99.67
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.66
1p9r_A418 General secretion pathway protein E; bacterial typ 99.66
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.64
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.64
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.63
2oap_1511 GSPE-2, type II secretion system protein; hexameri 99.62
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.61
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 99.61
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.61
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.6
2kjq_A149 DNAA-related protein; solution structure, NESG, st 99.59
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.59
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.57
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 99.53
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.5
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 99.47
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 99.47
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 99.46
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 99.43
1vma_A306 Cell division protein FTSY; TM0570, structural gen 99.42
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 99.41
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 99.4
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 99.38
2r6a_A454 DNAB helicase, replicative helicase; replication, 99.38
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 99.32
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.31
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 99.3
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 99.29
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.28
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.24
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.23
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 99.15
3kta_A182 Chromosome segregation protein SMC; structural mai 99.14
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 99.08
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.05
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 99.02
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.97
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.96
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.96
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.94
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 98.92
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.89
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 98.87
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.85
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.84
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.82
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.81
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 98.81
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 98.79
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 98.78
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.75
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 98.66
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 98.66
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.65
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 98.58
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 98.57
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.56
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 98.56
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.55
2z43_A324 DNA repair and recombination protein RADA; archaea 98.55
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.54
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.54
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 98.5
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 98.49
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 98.47
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.45
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.42
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.39
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.37
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 98.32
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 98.31
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.26
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.25
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.22
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.22
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.21
3ice_A422 Transcription termination factor RHO; transcriptio 98.17
1kag_A173 SKI, shikimate kinase I; transferase, structural g 98.15
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.12
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.12
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 98.12
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 98.08
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.03
1u94_A356 RECA protein, recombinase A; homologous recombinat 98.02
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 98.02
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.01
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.99
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.98
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.97
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.92
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 97.87
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.84
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.84
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.83
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 97.82
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.79
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 97.77
3bos_A242 Putative DNA replication factor; P-loop containing 97.75
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.72
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 97.71
2wji_A165 Ferrous iron transport protein B homolog; membrane 97.69
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.68
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.67
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 97.66
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.62
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 97.62
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.61
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.61
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 97.58
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.55
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.55
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.5
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.48
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.48
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.46
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.45
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.45
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.39
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.37
3io5_A 333 Recombination and repair protein; storage dimer, i 97.35
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 97.34
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 97.32
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.3
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 97.28
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 97.26
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.25
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.23
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.23
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.2
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 97.18
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 97.17
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.16
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.14
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 97.11
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.1
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.09
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 97.09
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.07
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 97.07
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.06
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.02
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.02
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 97.01
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.01
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.0
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 96.99
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.98
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.97
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.96
1via_A175 Shikimate kinase; structural genomics, transferase 96.95
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.93
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.92
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.9
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.89
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.88
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 96.86
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.84
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 96.82
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.8
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 96.8
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.8
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.79
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.77
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.76
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.74
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.74
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.73
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.72
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 96.72
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 96.71
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.63
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 96.63
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.63
2ged_A193 SR-beta, signal recognition particle receptor beta 96.62
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 96.61
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.59
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.58
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 96.57
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 96.57
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 96.56
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.55
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.54
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.54
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 96.52
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 96.52
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.51
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.51
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 96.51
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 96.51
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.5
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 96.5
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.49
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 96.49
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.48
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 96.48
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.48
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 96.48
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.47
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.47
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 96.46
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 96.45
3iby_A256 Ferrous iron transport protein B; G protein, G dom 96.45
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 96.44
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 96.44
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 96.44
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.43
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 96.43
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 96.43
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.42
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 96.42
3lxw_A247 GTPase IMAP family member 1; immunity, structural 96.41
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 96.4
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 96.4
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.38
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 96.38
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.37
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 96.36
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 96.36
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.36
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 96.33
3t1o_A198 Gliding protein MGLA; G domain containing protein, 96.33
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 96.33
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 96.33
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 96.31
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 96.31
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 96.3
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 96.3
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 96.29
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 96.27
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.26
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 96.25
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.25
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 96.23
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 96.23
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 96.23
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 96.23
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 96.22
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 96.22
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 96.22
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 96.21
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 96.18
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.18
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 96.15
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 96.15
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 96.14
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.13
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 96.13
1nrj_B218 SR-beta, signal recognition particle receptor beta 96.13
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 96.12
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 96.12
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 96.1
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.1
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 96.1
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 96.1
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 96.1
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 96.09
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.09
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 96.09
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 96.08
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 96.07
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 96.06
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 96.05
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 96.04
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 96.03
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 96.03
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.02
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 96.01
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 96.0
3cnl_A262 YLQF, putative uncharacterized protein; circular p 96.0
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 96.0
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 95.99
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 95.98
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 95.98
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 95.97
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 95.97
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 95.97
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.97
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 95.96
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 95.96
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 95.96
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 95.95
3llu_A196 RAS-related GTP-binding protein C; structural geno 95.95
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 95.94
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 95.94
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 95.93
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 95.93
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 95.92
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 95.92
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.92
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.91
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 95.91
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 95.91
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 95.91
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 95.9
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 95.9
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 95.89
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 95.89
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 95.89
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 95.88
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.88
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 95.87
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 95.85
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 95.84
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 95.84
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 95.81
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 95.79
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 95.78
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 95.78
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.74
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 95.74
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 95.74
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 95.73
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 95.73
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 95.72
2fh5_B214 SR-beta, signal recognition particle receptor beta 95.72
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 95.71
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 95.7
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 95.7
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 95.7
2r62_A268 Cell division protease FTSH homolog; ATPase domain 95.69
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.69
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.68
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 95.68
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 95.66
2hf9_A226 Probable hydrogenase nickel incorporation protein 95.62
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 95.61
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.58
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 95.55
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 95.54
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.53
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 95.47
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 95.47
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 95.46
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 95.42
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 95.4
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 95.33
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.29
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 95.27
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 95.1
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.1
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 95.08
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.06
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.06
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 94.98
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 94.98
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 94.97
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 94.92
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 94.91
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 94.89
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.88
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 93.78
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 94.73
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 94.73
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 94.73
3pvs_A 447 Replication-associated recombination protein A; ma 94.72
1wxq_A397 GTP-binding protein; structural genomics, riken st 94.69
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 94.67
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.59
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.56
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 94.54
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 94.54
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 94.54
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.5
2qgz_A308 Helicase loader, putative primosome component; str 94.5
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.5
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 94.46
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 94.44
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
Probab=100.00  E-value=4.1e-63  Score=468.16  Aligned_cols=234  Identities=37%  Similarity=0.613  Sum_probs=207.7

Q ss_pred             CCCeEEEEeEEEEeCCC---CcceeeeeEEEeCCcEEEEEcCCCccHHHHHHHHhcCCCCCccEEEECCEeCCCCCHHH-
Q 022337           60 QKPKFRVRELRKESDDG---APILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLS-  135 (298)
Q Consensus        60 ~~~~l~~~~l~~~y~~~---~~vL~~isl~i~~Ge~~~iiG~nGsGKSTLlk~l~gl~~p~~G~I~i~g~~i~~~~~~~-  135 (298)
                      .+++|+++||+|+|+++   .++|+||||+|++||++||+||||||||||+|+|+|+++|++|+|.++|+++..++..+ 
T Consensus        21 ~~~mi~v~~ls~~y~~~~~~~~aL~~vsl~i~~Gei~~IiGpnGaGKSTLlr~i~GL~~p~~G~I~i~G~~i~~~~~~~~  100 (366)
T 3tui_C           21 DKHMIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESEL  100 (366)
T ss_dssp             --CCEEEEEEEEEEECSSSEEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSCCSEEEEEETTEECSSCCHHHH
T ss_pred             CCceEEEEeEEEEeCCCCCCeEEEEeeEEEEcCCCEEEEEcCCCchHHHHHHHHhcCCCCCceEEEECCEECCcCCHHHH
Confidence            45689999999999532   36999999999999999999999999999999999999999999999999998877543 


Q ss_pred             --HhcceEEEeCCCCCCcc-cHHHHhHhCccccCCCc--cHHHHHHHHHHcCCCchhhcCCCCCCChhHHHHHHHHHHHc
Q 022337          136 --LRRKVGMLFQIPALFEG-TVVDNIRYGPQLRGKKL--TENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLA  210 (298)
Q Consensus       136 --~~~~ig~v~Q~~~l~~~-tv~eni~~~~~~~~~~~--~~~~~~~~l~~~~l~~~~~~~~~~~LSgGqkQRv~iAral~  210 (298)
                        +|++||||||++.+++. ||+||+.++....+...  .++++.++++.+||. ++.++++.+|||||||||+|||||+
T Consensus       101 ~~~r~~Ig~v~Q~~~l~~~~TV~env~~~~~~~~~~~~~~~~~v~~lL~~vgL~-~~~~~~~~~LSGGqkQRVaIArAL~  179 (366)
T 3tui_C          101 TKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLG-DKHDSYPSNLSGGQKQRVAIARALA  179 (366)
T ss_dssp             HHHHTTEEEECSSCCCCTTSCHHHHHHHHHHHSCCCHHHHHHHHHHHHHHHTCG-GGTTCCTTTSCHHHHHHHHHHHHTT
T ss_pred             HHHhCcEEEEeCCCccCCCCCHHHHHHHHHHhcCCCHHHHHHHHHHHHHHcCCc-hHhcCChhhCCHHHHHHHHHHHHHh
Confidence              46789999999999875 99999999865544332  345688999999996 5889999999999999999999999


Q ss_pred             CCCCeEEEeCcCCCCCHHHHHHHHHHHHHHHhcCCcEEEEEccCHHHHHhhcCEEEEEeCCEEEEeeChhhhhc-cCChH
Q 022337          211 NEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSE-AKHPM  289 (298)
Q Consensus       211 ~~p~illLDEPts~LD~~~~~~~~~~l~~l~~~~g~tii~itHd~~~~~~~~d~v~vl~~G~i~~~g~~~~~~~-~~~~~  289 (298)
                      .+|++|||||||||||+.+++.++++|++++++.|+|||+||||++.+..+||||++|++|++++.|+++++.. +.+++
T Consensus       180 ~~P~lLLlDEPTs~LD~~~~~~i~~lL~~l~~~~g~Tii~vTHdl~~~~~~aDrv~vl~~G~iv~~g~~~ev~~~p~~~~  259 (366)
T 3tui_C          180 SNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFSHPKTPL  259 (366)
T ss_dssp             TCCSEEEEESTTTTSCHHHHHHHHHHHHHHHHHSCCEEEEEESCHHHHHHHCSEEEEEETTEEEECCBHHHHHSSCCSHH
T ss_pred             cCCCEEEEECCCccCCHHHHHHHHHHHHHHHHhCCCEEEEEecCHHHHHHhCCEEEEEECCEEEEEcCHHHHHhCCCcHH
Confidence            99999999999999999999999999999987779999999999999999999999999999999999998754 34556


Q ss_pred             HHHHh
Q 022337          290 ALRFL  294 (298)
Q Consensus       290 ~~~~~  294 (298)
                      .+.|.
T Consensus       260 ~~~~~  264 (366)
T 3tui_C          260 AQKFI  264 (366)
T ss_dssp             HHHHH
T ss_pred             HHHHH
Confidence            55554



>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 298
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 2e-64
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 9e-64
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 3e-63
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 2e-62
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 1e-61
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 1e-60
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 4e-60
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 2e-58
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 2e-58
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 1e-57
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 3e-54
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 2e-53
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 7e-53
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 1e-50
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 2e-50
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 3e-50
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 9e-50
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 3e-49
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 6e-49
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 7e-46
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 8e-23
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 4e-14
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 9e-07
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 4e-14
g1ii8.1 369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 8e-04
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 2e-06
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 1e-04
d1rz3a_198 c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci 5e-04
d1x6va3195 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kin 9e-04
d1m8pa3183 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d 0.001
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 0.001
d1znwa1182 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacteriu 0.001
d1xjca_165 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 0.002
d1y63a_174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 0.002
d1np6a_170 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 0.002
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 0.003
d2p67a1327 c.37.1.10 (A:1-327) LAO/AO transport system kinase 0.003
d1uj2a_213 c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho 0.004
d1s96a_205 c.37.1.1 (A:) Guanylate kinase {Escherichia coli [ 0.004
d1lvga_190 c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculu 0.004
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 0.004
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
 Score =  200 bits (511), Expect = 2e-64
 Identities = 67/240 (27%), Positives = 121/240 (50%), Gaps = 8/240 (3%)

Query: 59  IQKPKFRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPS 118
           I+  + ++  L K        +  +N+ I  G  + ++GPSG GK+T LR +  L EP  
Sbjct: 2   IKMVEVKLENLTK-RFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTE 60

Query: 119 GTVFLDGRDITDLDVLSLRRKVGMLFQIPALFEG-TVVDNIRYGPQLRG--KKLTENEVY 175
           G ++   RD+T L      R + M+FQ  A++   TV +NI +  +++   K   +  V 
Sbjct: 61  GRIYFGDRDVTYLP--PKDRNISMVFQSYAVWPHMTVYENIAFPLKIKKFPKDEIDKRVR 118

Query: 176 KLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVLLLDEPTSALDPISTQNIED 235
               L  ++   LN+   ++S GQ QRVA+AR +  EP+VLL+DEP S LD      +  
Sbjct: 119 WAAELLQIEE-LLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRA 177

Query: 236 VLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKP-DLLSEAKHPMALRFL 294
            + KL++K  +T + V+H   +   + D + ++  G+++++  P ++           F+
Sbjct: 178 EIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFI 237


>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Length = 195 Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 182 Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Length = 165 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Length = 327 Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.92
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.83
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.79
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 99.49
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 99.27
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 99.15
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 98.44
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 98.34
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 97.94
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.87
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.86
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.78
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.72
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.65
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.64
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.62
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.6
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.56
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.52
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.48
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 97.46
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.45
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.4
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.39
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.39
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.35
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.33
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.31
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.3
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.28
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.28
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.27
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.21
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.19
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 97.15
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.12
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.11
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.03
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.03
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.02
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.01
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.0
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 97.0
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.99
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.96
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.95
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.94
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 96.93
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 96.93
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.9
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.9
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.87
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.87
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.87
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.86
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 96.84
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.83
d1nrjb_209 Signal recognition particle receptor beta-subunit 96.83
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.82
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.82
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.82
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.81
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.79
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.76
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.71
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.7
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.7
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.7
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 96.65
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.64
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.61
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.6
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.59
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 96.58
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.57
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 96.56
d1okkd2207 GTPase domain of the signal recognition particle r 96.56
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.56
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.54
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.52
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.51
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.49
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 96.45
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 96.45
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.43
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.41
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 96.38
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.38
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.36
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.35
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.33
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.32
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 96.32
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.3
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.3
d1vmaa2213 GTPase domain of the signal recognition particle r 96.24
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.23
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 96.23
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.19
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.18
d2qy9a2211 GTPase domain of the signal recognition particle r 96.15
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 96.13
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.13
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.11
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.09
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.06
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 96.05
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.04
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.03
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.02
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.02
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.99
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.97
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 95.96
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.94
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 95.88
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.87
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.87
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.87
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.86
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 95.81
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.81
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 95.78
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.78
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 95.78
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 95.77
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 95.77
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.76
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.73
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.72
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 95.72
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 95.71
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 95.71
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.69
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 95.66
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 95.65
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 95.64
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 95.64
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 95.62
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 95.6
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 95.58
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 95.56
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.55
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 95.54
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 95.51
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 95.49
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 95.43
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.42
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.41
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 95.4
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 95.39
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.39
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 95.37
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 95.34
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.34
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.33
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 95.33
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 95.29
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.26
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 95.24
d1xpua3289 Transcription termination factor Rho, ATPase domai 95.23
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.23
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.19
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.17
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 95.17
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 95.17
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 95.14
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 95.11
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.1
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.06
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 95.04
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 95.03
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 94.99
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 94.94
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 94.94
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.9
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.85
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 94.84
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 94.79
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.78
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 94.76
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.75
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.71
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 94.69
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 94.68
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 94.57
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 94.43
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 94.3
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 94.28
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 94.05
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.03
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.0
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 93.97
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 93.73
d1svma_362 Papillomavirus large T antigen helicase domain {Si 93.58
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 93.53
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.4
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 93.35
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 93.35
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 93.08
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 93.07
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 92.99
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.76
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 92.72
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 92.69
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 92.54
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 92.44
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 92.29
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 92.22
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.21
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.46
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 91.39
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 91.1
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.06
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 90.98
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 90.85
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 90.31
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 90.29
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 90.26
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 90.06
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 89.89
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 89.72
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 89.39
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.8
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 88.59
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 88.33
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 87.82
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 87.54
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 87.35
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 86.93
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 86.72
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 86.55
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 86.45
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 86.41
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 85.93
d1tuea_205 Replication protein E1 helicase domain {Human papi 85.92
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 85.82
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 85.76
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 84.24
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 84.16
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 84.05
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 84.0
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 83.75
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 82.44
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 82.39
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 81.27
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 80.92
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00  E-value=1.8e-69  Score=481.72  Aligned_cols=230  Identities=28%  Similarity=0.465  Sum_probs=203.6

Q ss_pred             CeEEEEeEEEEeCCCCcceeeeeEEEeCCcEEEEEcCCCccHHHHHHHHhcCCCCCccEEEECCEeCCCCCHHHHhcceE
Q 022337           62 PKFRVRELRKESDDGAPILKGVNMEIPKGVIMGIIGPSGSGKSTLLRALNRLWEPPSGTVFLDGRDITDLDVLSLRRKVG  141 (298)
Q Consensus        62 ~~l~~~~l~~~y~~~~~vL~~isl~i~~Ge~~~iiG~nGsGKSTLlk~l~gl~~p~~G~I~i~g~~i~~~~~~~~~~~ig  141 (298)
                      ..|+++||+|+|+ +.+||+||||+|++||+++|+||||||||||+|+|+|+++|++|+|+++|+++...+.  .+++||
T Consensus         5 ~~I~v~nlsk~yg-~~~al~~vsl~v~~Ge~~~liGpsGaGKSTLl~~i~Gl~~p~sG~I~i~g~~i~~~~~--~~r~ig   81 (239)
T d1v43a3           5 VEVKLENLTKRFG-NFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPP--KDRNIS   81 (239)
T ss_dssp             CCEEEEEEEEEET-TEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSCCSEEEEEETTEECTTSCG--GGGTEE
T ss_pred             CeEEEEEEEEEEC-CEEEEcceeEEECCCCEEEEECCCCChHHHHHHHHHcCCCCCCCEEEEcceecccCCc--ccceEE
Confidence            4599999999994 6789999999999999999999999999999999999999999999999999987764  357899


Q ss_pred             EEeCCCCCCcc-cHHHHhHhCccccCCCc--cHHHHHHHHHHcCCCchhhcCCCCCCChhHHHHHHHHHHHcCCCCeEEE
Q 022337          142 MLFQIPALFEG-TVVDNIRYGPQLRGKKL--TENEVYKLLSLADLDSSFLNKTGGEISVGQAQRVALARTLANEPEVLLL  218 (298)
Q Consensus       142 ~v~Q~~~l~~~-tv~eni~~~~~~~~~~~--~~~~~~~~l~~~~l~~~~~~~~~~~LSgGqkQRv~iAral~~~p~illL  218 (298)
                      ||||++.+|+. ||+||+.|+...++.+.  .++++.++++.++++ ++.++++.+|||||||||+|||||+.+|++|||
T Consensus        82 ~v~Q~~~l~~~ltv~enl~~~~~~~~~~~~~~~~~~~~~l~~~~l~-~~~~~~~~~LSGGq~QRvaiAraL~~~P~iLll  160 (239)
T d1v43a3          82 MVFQSYAVWPHMTVYENIAFPLKIKKFPKDEIDKRVRWAAELLQIE-ELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLM  160 (239)
T ss_dssp             EEEC------CCCHHHHHHTTCC--CCCHHHHHHHHHHHHHHTTCG-GGTTSCTTTCCSSCHHHHHHHHHHTTCCSEEEE
T ss_pred             EEeechhhcccchHHHHHHHHHHHcCCCHHHHHHHHHHHHHHcCCh-hhhcCChhhCCHHHHHHHHHHhhhccCCCceee
Confidence            99999999985 99999999987666543  346788999999996 689999999999999999999999999999999


Q ss_pred             eCcCCCCCHHHHHHHHHHHHHHHhcCCcEEEEEccCHHHHHhhcCEEEEEeCCEEEEeeChhhhhc-cCChHHHHHhh
Q 022337          219 DEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSE-AKHPMALRFLQ  295 (298)
Q Consensus       219 DEPts~LD~~~~~~~~~~l~~l~~~~g~tii~itHd~~~~~~~~d~v~vl~~G~i~~~g~~~~~~~-~~~~~~~~~~~  295 (298)
                      ||||+||||.++.+++++|++++++.|+|+|+||||++++.++||||++|++|+|++.|+++++.+ +.+.+...|++
T Consensus       161 DEPts~LD~~~~~~i~~ll~~l~~~~g~tii~vTHd~~~a~~~~dri~vm~~G~iv~~G~~~el~~~P~~~~~~~~lg  238 (239)
T d1v43a3         161 DEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIG  238 (239)
T ss_dssp             ESTTTTSCHHHHHHHHHHHHHHHHHHTCEEEEEESCHHHHHHHCSEEEEEETTEEEEEECHHHHHHCCSBHHHHHHSS
T ss_pred             cCCcccCCHHHHHHHHHHHHHHHHhcCCeEEEEeCCHHHHHHhCCEEEEEECCEEEEEcCHHHHHhCCCCHHHHHhhC
Confidence            999999999999999999999987779999999999999999999999999999999999999864 45677777764



>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure