Citrus Sinensis ID: 022346


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MEQEADSAYKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMNNIPQNS
cccccccccHHHHccccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHccccccccCEEEEEEEECcccccccccEEEEEEcccccHHHHcccccHHHHHHHcccccccccccccccccccEEEEEEcccEEEEEEEcccccccccCEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEEECccccccEEEEEEEccccHHHHHHHHHccccccccccEEEEEHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccc
*****DS*YKLLLSCPHGFSPSEVSVVFDESYDRVPHP**NLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDA*************FINHKVSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMN******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQEADSAYKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMNNIPQNS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nudix hydrolase 9 Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.probableQ8VYR2
Nucleoside diphosphate-linked moiety X motif 22 probableQ6P9U1
Nucleoside diphosphate-linked moiety X motif 22 probableQ2TBI8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OGA, chain A
Confidence level:very confident
Coverage over the Query: 126-168,191-269
View the alignment between query and template
View the model in PyMOL
Template: 3R03, chain A
Confidence level:confident
Coverage over the Query: 128-168,191-291
View the alignment between query and template
View the model in PyMOL
Template: 3QSJ, chain A
Confidence level:confident
Coverage over the Query: 139-208
View the alignment between query and template
View the model in PyMOL
Template: 3FSP, chain A
Confidence level:confident
Coverage over the Query: 17-169,192-240,252-269
View the alignment between query and template
View the model in PyMOL